SecReT4
Protein ID: 18466485
T4SS name [ID]Tra_F [578]
Gene symbol-
Locus tagHCM1.71
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]45878..47110 [+]
Productperiplasmic protein
Component typeTraK_F
UniProt IDQ9RGT4
KEGG IDsty:HCM1.71
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 3.7e-11, Aligned region: 151..388
Protein Sequence: 410 a.a.     [Download]
>gi|18466485|ref|NP_569293.1| periplasmic protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MTSKKVFHCTAITAVILLATSNVVFAEDYQLPATVNNPVVMPVGADEFQNGVKNAIIKDTGTTTETVQAT
KPTTALPSLSPASSASPAVNEITGALSNNPTLAGYQQQVKSGNFDSYGRPAGKEPQQNAQSTGSPSKADE
LYVEARNRYKEVQRVNVPPGGNIVLPVSRGLQNRISTSFKNASVSTSTPADEASIFVNGGDVFISTNTDK
PIGIMLSEDSVPESTYNLTLVPLDVPGAMISVTTSLSPTMQAKRETSLDKQNYDEMLARSQSEELTPSDP
RQDDHKQRIIDLLTPVALGEVPSGFSLQEDRLSRIPSSEQSPCNFNMYAKLGQRLVGSRELIDVVLVKND
KPYGQVVADQQCITEGVVASALFDKAFLQPGEETELYIVRDKLFKERQTRVTTRPSLIKR
 
Nucleotide Sequence: 1233 bp     [Download]
>gi|18466424|ref|NC_003384.1|:45878-47110 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGACTTCAAAAAAGGTTTTTCACTGCACCGCGATTACAGCAGTGATTTTGCTGGCAACTTCGAATGTGG
TATTTGCTGAAGACTATCAGTTACCGGCGACAGTAAATAATCCGGTAGTTATGCCTGTCGGGGCCGATGA
ATTTCAGAACGGTGTGAAAAATGCGATAATTAAAGACACTGGCACTACGACTGAGACCGTACAAGCAACA
AAACCGACAACTGCTCTGCCAAGTCTTTCACCTGCAAGCAGTGCTTCTCCCGCAGTCAATGAAATAACCG
GGGCGTTGTCAAATAACCCTACTCTAGCTGGTTACCAGCAACAGGTTAAATCAGGAAATTTTGATAGTTA
CGGAAGACCAGCAGGGAAAGAACCTCAACAAAATGCACAAAGTACCGGGTCCCCTTCAAAGGCAGATGAA
CTTTATGTTGAAGCACGTAATCGCTATAAAGAAGTACAACGAGTAAACGTTCCGCCTGGTGGCAATATTG
TACTCCCGGTTTCTCGGGGGCTGCAAAACAGAATTTCGACTTCATTTAAAAATGCATCTGTAAGTACTTC
AACGCCAGCTGATGAAGCCAGTATTTTCGTTAATGGCGGGGATGTTTTTATTTCAACAAATACAGATAAG
CCTATAGGAATTATGCTTTCAGAAGATTCAGTTCCTGAATCTACTTATAACCTGACACTGGTTCCACTGG
ATGTACCAGGGGCCATGATTTCAGTAACAACTTCTTTGAGCCCGACAATGCAGGCAAAACGAGAAACTTC
TCTTGATAAACAAAATTATGATGAGATGCTGGCACGCTCACAATCAGAAGAGTTGACTCCTTCAGACCCT
CGGCAGGATGACCATAAACAGCGGATCATTGATTTGTTGACTCCGGTTGCACTGGGTGAGGTTCCTTCTG
GTTTCAGTTTACAAGAAGACCGCTTGTCACGCATACCAAGCTCAGAGCAGTCCCCATGTAATTTCAATAT
GTACGCCAAGTTAGGTCAAAGACTGGTGGGATCTCGGGAATTGATAGATGTCGTTCTTGTTAAGAATGAT
AAGCCTTACGGACAGGTAGTGGCTGATCAGCAATGTATAACTGAAGGCGTGGTTGCAAGCGCTCTATTCG
ATAAAGCATTCCTTCAGCCCGGGGAAGAGACCGAACTTTATATTGTGCGGGATAAATTATTTAAAGAGCG
TCAGACTCGTGTTACTACGCGCCCAAGCCTGATTAAAAGATAA
 Primer design