SecReT4
Protein ID: 18466487
T4SS name [ID]Tra_F [578]
Gene symboltrhB
Locus tagHCM1.73
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]47542..48900 [+]
Productplasmid transfer protein
Component typeTraB_F
UniProt IDQ9L5U6
KEGG IDsty:HCM1.73
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.5e-39, Aligned region: 240..444
Protein Sequence: 452 a.a.     [Download]
>gi|18466487|ref|NP_569295.1| plasmid transfer protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MDIKKAWENKTVRISVIGAALMVLIVVISQSIFTTPVKKEKKTQKKDMQTGFLIDDSQMNKLSNEESQKT
YNEMVRQNRIDQNAAKADRDKAEKAQQENKAQIASLASQVQQLTTQLTEMQTSRNGNRNLDAGGPRNNVN
EQAPAKPYQLNPNAAVNGVSSGYAPISPTRNSPMRTITQSSIKTNGTDGVIQVMPISENRIREGREVVAG
SEKAPTRTIRGDGTAPVDSKARHAARKDEMFLPATSIITGVLITGLEAPTSLSSKAEPMPVTMRIKKDII
MPNNYTMDLRDCNLLGSAVGDLASQRAYIRATSISCVNSKGKAFDVIVEAYAVSENDGKNGIRGNLISRN
GNAIAGSAFAGGLSALAGSLSPSKVSSLNIDPNSTAQYQSPNIGALGALAGAGAAQGGLNRLVDYYTSIA
EQQWPIVEISPGRPITFVVQKGATIPTNLTSR
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|18466424|ref|NC_003384.1|:47542-48900 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGGACATTAAAAAGGCCTGGGAAAATAAAACTGTCAGAATCTCAGTAATTGGTGCTGCATTGATGGTAT
TGATTGTTGTCATCAGTCAATCAATCTTTACCACACCAGTTAAAAAAGAGAAGAAAACCCAGAAAAAAGA
TATGCAAACTGGATTCCTTATTGATGATTCACAAATGAACAAGCTGAGTAATGAGGAAAGCCAGAAGACT
TATAACGAAATGGTAAGGCAGAACCGTATTGACCAGAACGCTGCCAAGGCTGACCGTGACAAAGCTGAAA
AGGCTCAGCAAGAAAACAAAGCACAGATAGCCAGTCTTGCTTCGCAAGTTCAGCAACTCACTACGCAGTT
GACTGAAATGCAGACCTCAAGAAATGGTAATCGCAATCTCGATGCAGGCGGACCACGCAACAACGTCAAT
GAACAAGCCCCAGCAAAGCCATACCAGCTTAATCCAAATGCAGCGGTGAACGGGGTTAGTTCTGGATACG
CACCTATATCTCCGACCCGAAACAGTCCAATGCGGACAATAACACAGAGTTCAATTAAGACAAACGGCAC
TGATGGTGTCATTCAGGTGATGCCGATATCAGAGAACCGGATCAGAGAGGGGCGCGAGGTTGTTGCGGGA
AGTGAAAAGGCCCCAACGCGAACTATTCGCGGCGATGGGACTGCACCTGTTGATAGTAAAGCTCGTCATG
CGGCCCGTAAGGATGAAATGTTTCTTCCAGCGACGTCAATTATTACTGGGGTGCTAATTACCGGGCTGGA
AGCTCCAACGAGTTTGTCCTCTAAAGCAGAACCGATGCCGGTTACCATGCGCATTAAAAAAGACATCATC
ATGCCTAACAATTACACGATGGATTTGCGTGATTGTAATTTATTGGGTTCTGCTGTGGGGGATCTGGCAT
CTCAGCGTGCGTACATTAGGGCAACCTCCATATCGTGTGTCAACTCGAAAGGAAAAGCATTCGACGTAAT
AGTGGAAGCTTATGCGGTTAGTGAAAATGACGGGAAAAATGGCATTCGTGGGAATCTGATAAGCAGAAAT
GGAAATGCGATTGCAGGTTCTGCGTTTGCAGGAGGGCTGTCAGCATTGGCGGGGAGTCTGAGTCCATCAA
AGGTGTCTTCGCTTAATATAGATCCAAACTCTACGGCACAATACCAATCGCCAAACATAGGTGCATTAGG
AGCGCTGGCCGGAGCCGGTGCAGCTCAGGGGGGTCTAAACCGTCTTGTGGACTACTATACGTCAATAGCT
GAGCAGCAGTGGCCAATTGTAGAAATTAGCCCAGGGCGCCCAATTACTTTTGTCGTTCAAAAAGGGGCGA
CAATACCTACAAACCTGACAAGCCGCTGA
 Primer design