SecReT4
Protein ID: 18466490
T4SS name [ID]Tra_F [578]
Gene symboltrhV
Locus tagHCM1.76
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]50289..51239 [+]
Productplasmid transfer protein
Component typeTraV_F
UniProt IDQ9RGT9
KEGG IDsty:HCM1.76
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 2e-11, Aligned region: 28..271
Protein Sequence: 316 a.a.     [Download]
>gi|18466490|ref|NP_569298.1| plasmid transfer protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MNIKKVIFSALVVGSSSYLAGCTIGSAESECPGIEKGVICKGPREVMELTNNRDDLSGLGEEEANSGKGK
SAVNDSQYPAQLTPPGAVQYPKSSVLVNKPVTYTTTEVKPVGQLPVMYDQTLKMGAPTSTIGPRPISGNP
VNSNVRMTTSYNSNGSSVNPFLHPSAEVVKKTTQVVTPAPAPRYVAPNSDINASKDLYSINNGQPVNPTL
SSGQVQQYRTQGYKQAVVAPEPLAVLQQGRVMRITFAPYTDDNDALNLPGFVYVNVKPQTWIAGKNSTSN
PARIVPLEVQDAARENMQQQQRATKAVSSNGIVRQL
 
Nucleotide Sequence: 951 bp     [Download]
>gi|18466424|ref|NC_003384.1|:50289-51239 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGAACATTAAAAAAGTTATTTTCAGCGCTCTGGTTGTTGGTTCATCTTCATACCTGGCGGGTTGTACTA
TTGGCAGCGCAGAATCTGAATGCCCGGGAATTGAAAAAGGAGTTATTTGTAAAGGCCCGCGTGAAGTTAT
GGAACTGACGAACAATCGTGATGATCTCTCCGGCCTTGGGGAGGAAGAGGCTAATTCGGGAAAGGGGAAA
TCGGCTGTCAATGACAGCCAGTACCCTGCCCAACTAACGCCGCCTGGCGCAGTGCAGTACCCCAAGTCGT
CTGTACTTGTTAATAAGCCAGTGACATACACAACGACGGAAGTAAAACCGGTTGGACAGCTCCCGGTGAT
GTATGATCAGACATTAAAAATGGGGGCGCCAACTTCAACAATTGGACCACGGCCAATCAGCGGGAATCCT
GTTAATTCTAATGTACGGATGACAACGAGTTACAACTCAAATGGGTCATCCGTTAACCCCTTTTTGCATC
CGTCTGCTGAAGTCGTGAAAAAAACAACTCAGGTTGTTACTCCCGCGCCTGCACCGCGCTATGTAGCACC
AAATTCTGATATCAATGCAAGTAAAGACCTTTATTCCATTAACAATGGACAGCCAGTAAACCCTACGCTC
AGCTCTGGGCAGGTACAGCAATACCGTACACAAGGCTACAAACAGGCAGTCGTTGCACCAGAGCCTCTTG
CTGTGCTTCAGCAAGGCCGCGTCATGAGAATCACCTTTGCACCATATACGGATGATAATGACGCGCTAAA
TCTGCCTGGCTTTGTTTATGTGAATGTCAAACCGCAAACTTGGATTGCGGGCAAAAATTCAACATCAAAT
CCGGCACGAATTGTTCCTTTGGAAGTCCAGGATGCGGCTCGTGAAAATATGCAACAGCAACAGCGAGCAA
CGAAAGCAGTTTCGTCAAACGGTATTGTGAGACAACTCTGA
 Primer design