SecReT4
Protein ID: 18466491
T4SS name [ID]Tra_F [578]
Gene symboltrhC
Locus tagHCM1.77
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]51248..53929 [+]
Productplasmid transfer protein
Component typeTraC_F
UniProt IDQ935P3
KEGG IDsty:HCM1.77
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.7e-60, Aligned region: 456..812
TraC_F_IV [PF11130], Evalue: 6e-46, Aligned region: 13..258
Protein Sequence: 893 a.a.     [Download]
>gi|18466491|ref|NP_569299.1| plasmid transfer protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MRSANVYNKELSRHQLGGFIPVYDQIPGTHYFLLDGNRLGFMFICSPSPGVFDNQQDVLTELFKMDFPTD
TICQTSLTALPDLILHLSAWSAVRGGRMEGHDKLKGDLLTAYQLDYYDRSLNEPLKPDHDKLMLRDFQVW
ISFSIPLKSALPSEIEKSRIDALYSDLISKLNTVGLFPHKVGAENWLYCMDKLLHPGKTSRWSEGHVEAS
TMRRLNEQINVPGRKYTVTENHFSSTTQSNDISEHRYFKQLSVVKFPEFVNFGCMYELVVNWLNGRKTIF
SPFMITQTVHFADPLKLSRENVRYKAITNKQASIPTVLTFCPRLKDMDNDYMTITRELEDGARLLHSYLT
FTVMGNSAVDVQSAADQLKSFYLESRVNVADDSYIVFPSFVSSLPMCNDPKTILELDRFEVVSNTGAAHM
TPIFGPWKGNTDRPVLNLVSREGQLLGLDIFKTSASYNMVVGATSGAGKSFWVAYIINNYLGAGPRSNNL
IHYRDTFEGFKNNSYDAFDPDGAQIFVVDVGRSYQGISEQYTNSQFIDFGKKPDFTLNPFAFLTDVTVGE
RVFDEAPVFNDDSNNHDDDKDKVAQTIMVLNQLKIMASEKGNIDDFQQSVMLQLISEEYNESRKVGRTGS
ITGFARRCSNHEDKRIKDIGDQLGQWCEGGIYGNRFTENLPPINFDSRFIVLELEELKGTPHLQTVVLMS
IIQAAQHAMFIKKDGRRRLFILDEAWEYIRPDNASGSSNHSNQFFSSFLEAAWRRFRKTNCAGICITQSF
EDYFTSSVGRALTANSPWKIIMKQEKESIEAMKVNNYFSTTDAEYERMKNIRTVKRAFSEMLVRFENFQE
ICRLYVDRKMELCFTTDSTDRGKLWEIQSRLDCSYGEAIEILYEQEVASKSAA
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|18466424|ref|NC_003384.1|:51248-53929 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGAGATCAGCTAACGTCTATAATAAAGAATTAAGCCGTCATCAGTTAGGTGGATTTATTCCCGTGTATG
ATCAGATTCCGGGTACACATTATTTTCTACTTGACGGAAACCGACTCGGTTTTATGTTTATCTGTAGTCC
GTCGCCCGGTGTCTTTGATAATCAGCAGGATGTGTTAACTGAATTATTTAAAATGGACTTCCCAACTGAC
ACCATCTGTCAGACCTCATTAACTGCGCTGCCAGACTTGATCTTGCACTTAAGTGCCTGGTCTGCCGTTC
GTGGTGGTCGAATGGAAGGTCATGATAAGCTTAAGGGGGATTTACTCACTGCATATCAACTGGATTATTA
TGACCGAAGCCTGAATGAACCTTTGAAGCCGGACCACGATAAATTGATGCTTCGAGATTTTCAGGTCTGG
ATTTCCTTTTCAATTCCATTGAAGTCAGCACTTCCTTCTGAAATAGAAAAGAGTCGCATTGATGCGCTTT
ACTCTGACTTAATCAGTAAGTTGAATACAGTAGGCCTTTTCCCACACAAAGTTGGTGCTGAAAATTGGCT
TTATTGCATGGATAAGTTATTGCATCCGGGAAAAACATCGCGTTGGTCTGAAGGTCATGTTGAAGCTAGC
ACCATGAGACGCCTAAACGAGCAGATCAATGTACCGGGTCGAAAATATACAGTGACAGAGAATCATTTCT
CATCTACAACGCAGAGCAATGATATTTCTGAGCATCGTTATTTCAAACAATTATCAGTAGTGAAGTTTCC
AGAATTTGTAAACTTTGGCTGCATGTATGAACTTGTAGTTAATTGGTTGAATGGACGTAAAACGATCTTT
AGCCCTTTCATGATAACCCAGACTGTCCATTTCGCCGATCCTTTAAAATTATCAAGAGAAAACGTCAGAT
ATAAGGCAATTACTAACAAACAAGCCAGTATTCCAACAGTTTTGACGTTTTGTCCAAGATTAAAGGATAT
GGATAATGATTACATGACGATAACACGCGAACTGGAAGATGGGGCTCGCCTCCTACACAGTTATCTGACA
TTTACTGTAATGGGGAATTCAGCAGTTGATGTTCAGTCTGCCGCAGACCAGTTAAAATCATTTTATCTGG
AAAGTCGTGTTAATGTTGCTGATGACTCGTACATAGTATTTCCCTCATTTGTTTCAAGCCTGCCGATGTG
TAATGACCCAAAGACAATACTAGAACTGGATCGTTTTGAGGTCGTGAGTAATACTGGTGCTGCGCACATG
ACCCCCATATTTGGTCCTTGGAAAGGTAATACGGACAGACCCGTACTTAACCTTGTCTCACGAGAAGGAC
AGCTGTTGGGGCTGGATATCTTCAAGACTTCTGCCAGCTATAACATGGTCGTTGGTGCAACGTCTGGTGC
TGGTAAATCATTCTGGGTCGCATACATCATTAATAATTATCTAGGCGCAGGTCCGCGTTCTAATAATCTG
ATCCATTATCGAGATACTTTTGAGGGATTCAAAAACAATTCTTATGATGCATTTGACCCTGATGGAGCCC
AGATTTTCGTAGTTGATGTCGGACGCTCATACCAAGGTATTTCGGAACAATATACTAATAGTCAGTTTAT
AGACTTTGGGAAAAAGCCTGATTTTACGCTAAATCCATTCGCATTTTTGACTGATGTGACTGTTGGAGAG
CGTGTTTTTGATGAAGCACCTGTCTTTAATGACGATTCAAATAATCATGATGATGATAAGGATAAAGTAG
CCCAGACCATTATGGTTCTAAACCAGTTAAAAATAATGGCATCTGAAAAAGGAAATATTGACGATTTTCA
ACAATCGGTCATGCTGCAACTGATTAGTGAAGAATATAACGAATCACGCAAAGTTGGACGTACAGGCTCT
ATTACTGGATTTGCGCGACGCTGTTCTAACCATGAAGATAAGCGTATTAAAGATATCGGTGACCAGTTGG
GGCAATGGTGTGAAGGAGGGATTTATGGGAATCGCTTTACAGAAAATCTCCCGCCAATAAATTTTGATAG
CCGGTTTATTGTTCTGGAACTTGAAGAATTGAAGGGGACCCCACACCTTCAGACTGTCGTTCTGATGTCG
ATTATTCAGGCCGCTCAGCATGCAATGTTTATCAAGAAAGACGGACGCCGCCGGTTGTTCATACTTGATG
AGGCATGGGAGTATATCCGTCCGGACAATGCTTCAGGTTCCAGTAATCATTCAAATCAATTTTTCTCCTC
TTTCCTTGAGGCCGCTTGGCGCCGATTCAGGAAAACGAACTGTGCCGGTATTTGTATTACTCAATCCTTT
GAAGATTACTTCACCTCATCGGTTGGTCGCGCACTAACGGCTAACTCGCCGTGGAAGATCATCATGAAGC
AGGAAAAGGAAAGTATTGAAGCCATGAAGGTGAACAACTACTTCTCCACAACTGATGCGGAATATGAGCG
TATGAAAAATATTCGAACGGTAAAGCGTGCATTTTCCGAGATGCTCGTACGATTCGAAAATTTCCAGGAG
ATATGTCGCCTCTATGTAGATAGAAAAATGGAGCTTTGCTTTACGACTGACAGCACCGATCGTGGAAAAC
TATGGGAAATCCAAAGCCGACTTGATTGCTCTTACGGCGAAGCAATTGAGATTCTGTACGAACAGGAAGT
TGCGAGCAAATCAGCTGCCTGA
 Primer design