SecReT4
Protein ID: 18466505
T4SS name [ID]Tra_F [578]
Gene symboltrhW
Locus tagHCM1.99
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]71193..72701 [+]
Productplasmid transfer protein
Component typeTraW_F
UniProt IDQ935N8
KEGG IDsty:HCM1.99
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 2.2e-24, Aligned region: 195..276
Protein Sequence: 502 a.a.     [Download]
>gi|18466505|ref|NP_569313.1| plasmid transfer protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MRSFELKTTIKPLASCLAFYALISTAVASPQYQQVADDIARQAQVLGAQIPVPHASEGPLPSGSLDSPDT
KKYIRQAEAMKKNGDLSQQTNRGYVPGMNADSVQAVIDHTQAIRAQSNNSEAVNDIIRRRDEIQGNSQLS
ESALKSVENKPEVMRSQSSNIEKMFGSSGITAADFERKIDSSREEVLSTENGITIFASFSLPDYVLEDLL
RTASEHKARVVFNGLKKGTTRLPETQAAINQLVVKGKFDSPLITIDPDAFNQYQITQVPTIISREQSRFA
KMVGSFNVDFFQRELARKPDQDLFPIAGTTYPVEEKSIIKELEERAQKYDWDGAKKRAVADTWKNQYMVN
LPPAQEHKEWLIDPTIRVTQDVKDKQGRVIASAGELINPLARFPQNLTMIIFDPMNPGQLEWAEKQYRQR
LGSGQVMPMFTRIKQENGWDHLNDLREKFNGKVFKVNEQIIARFQIKNTPALISTEKEKFRITQFSEAEI
RGIGTKIAAEEN
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|18466424|ref|NC_003384.1|:71193-72701 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGCGATCTTTTGAATTAAAAACAACTATTAAGCCTCTGGCCTCCTGTCTGGCATTTTACGCCTTAATAT
CCACCGCTGTGGCTAGCCCCCAGTATCAACAGGTTGCTGATGACATTGCAAGGCAAGCTCAGGTTCTGGG
CGCCCAAATACCGGTACCACACGCATCAGAAGGTCCGCTCCCGTCTGGTTCTCTGGATTCTCCTGATACC
AAGAAATACATCCGCCAGGCCGAAGCTATGAAGAAAAACGGGGACCTCAGTCAGCAAACAAATCGCGGTT
ATGTCCCGGGTATGAATGCTGACAGTGTGCAGGCAGTTATAGACCATACGCAGGCTATCCGCGCTCAGAG
TAATAACTCGGAAGCAGTTAACGACATCATTCGCAGACGTGATGAGATTCAGGGAAATTCACAGCTCAGC
GAGTCTGCACTGAAATCCGTCGAAAATAAACCAGAAGTTATGCGCAGTCAGTCTTCGAATATCGAAAAGA
TGTTTGGTTCATCAGGAATCACCGCCGCTGACTTCGAGCGTAAAATAGACAGCAGTCGGGAAGAGGTGCT
CTCGACAGAAAACGGTATCACTATCTTTGCGTCATTTAGCTTGCCTGATTACGTCCTGGAAGATCTACTC
CGTACCGCGTCAGAACATAAGGCGAGAGTGGTTTTTAATGGTCTGAAGAAAGGCACTACACGCCTCCCTG
AAACTCAGGCAGCTATCAACCAGCTGGTGGTGAAGGGGAAGTTTGACTCCCCACTAATTACGATTGACCC
GGACGCATTTAACCAGTACCAGATCACGCAGGTCCCGACAATAATCTCCCGTGAGCAATCCCGGTTTGCA
AAAATGGTCGGCTCTTTCAACGTTGATTTCTTCCAGCGCGAACTGGCCAGAAAACCCGACCAAGATCTTT
TCCCGATTGCTGGTACGACCTATCCGGTTGAAGAGAAGAGCATTATTAAAGAGCTCGAAGAGCGAGCACA
GAAATACGACTGGGACGGCGCCAAGAAGAGAGCAGTCGCTGATACCTGGAAAAACCAGTACATGGTTAAT
CTGCCTCCCGCTCAAGAGCACAAGGAATGGCTAATCGACCCGACAATCAGGGTTACTCAGGACGTTAAAG
ATAAGCAGGGTCGCGTCATTGCTTCTGCTGGCGAGCTCATTAACCCACTGGCCAGGTTCCCGCAGAACCT
CACAATGATAATTTTTGACCCAATGAACCCAGGGCAACTTGAGTGGGCAGAGAAGCAATATCGCCAGCGT
CTTGGCAGCGGTCAGGTGATGCCGATGTTCACGCGCATCAAACAGGAAAATGGATGGGATCATTTGAATG
ATCTGCGCGAAAAATTCAATGGGAAGGTGTTCAAAGTTAATGAGCAAATTATTGCTCGTTTCCAGATAAA
AAACACGCCAGCGCTGATCTCCACTGAAAAAGAGAAATTCCGTATAACGCAATTCAGTGAAGCTGAAATA
CGTGGTATTGGAACAAAAATCGCGGCAGAGGAGAATTGA
 Primer design