SecReT4
Protein ID: 18466506
T4SS name [ID]Tra_F [578]
Gene symboltrhU
Locus tagHCM1.100
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]72891..73898 [+]
Productplasmid transfer protein
Component typeTraU_F
UniProt IDQ9RGV7
KEGG IDsty:HCM1.100
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.4e-71, Aligned region: 32..331
Protein Sequence: 335 a.a.     [Download]
>gi|18466506|ref|NP_569314.1| plasmid transfer protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MLSLSLPAMTMAADTGVPGAMCQSAGVWQGLIKNICWSCIFPMRIMGIGAAPEGAAPSRPGCYCTDQNGI
PEIGWQLSFFQPVKIVEVVKSPWCSPFLEGTMLQKSQFDIGKSNTNQPMTATEAGFYDVHLWEFPIMTML
KLLVIGECTAEPYVDASLTYISEVDPMWESDLLTLVLNPEAVVFANPIASMVCAADCVAVTAGKDNLAAY
FCAGCDGNLYPLTGHIYANDDAVRTSSLITQRLLTKLHRQGMLMRTMGADAMCEKTWEYFTPRSQYRLSM
LYPTPEANGPDCCHRLGDSVHDWSTLKGGRKKIGIDNYVYMLWRYNDCCVRYIPN
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|18466424|ref|NC_003384.1|:72891-73898 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGCTGTCGCTCTCGCTGCCTGCAATGACAATGGCCGCAGATACCGGTGTCCCGGGAGCAATGTGCCAGT
CAGCGGGAGTATGGCAGGGCCTAATCAAAAACATCTGCTGGAGTTGTATCTTCCCGATGCGGATCATGGG
AATTGGAGCAGCCCCTGAAGGTGCCGCCCCCTCACGCCCTGGTTGCTATTGCACGGATCAAAATGGGATA
CCAGAAATCGGATGGCAGCTAAGTTTTTTCCAACCAGTAAAAATTGTTGAAGTGGTGAAAAGTCCGTGGT
GCAGCCCATTTTTAGAGGGAACCATGCTGCAAAAATCACAGTTCGACATCGGCAAGAGCAATACTAACCA
GCCTATGACCGCAACAGAAGCCGGATTCTACGACGTACATCTCTGGGAATTCCCAATCATGACGATGTTG
AAATTGCTGGTTATTGGTGAATGTACAGCAGAACCTTATGTTGATGCCAGTCTGACGTATATCAGCGAAG
TAGATCCGATGTGGGAAAGTGACCTATTGACGCTCGTGCTAAACCCCGAAGCTGTGGTATTTGCAAACCC
TATCGCCTCAATGGTATGTGCAGCTGACTGCGTGGCCGTGACTGCCGGGAAGGATAATTTGGCTGCATAT
TTTTGTGCCGGGTGTGATGGGAACCTTTATCCGTTAACTGGACACATCTATGCGAATGATGATGCCGTCA
GAACCAGCTCACTTATAACTCAGCGTCTACTGACGAAGTTACATAGGCAGGGAATGCTTATGAGAACAAT
GGGAGCTGACGCAATGTGTGAAAAAACGTGGGAATACTTCACTCCTCGATCTCAATACCGACTTTCAATG
CTTTACCCAACGCCGGAGGCGAATGGTCCGGATTGCTGTCATCGCCTAGGCGATTCTGTCCATGACTGGT
CAACGCTTAAAGGTGGACGGAAAAAAATCGGCATAGATAACTATGTTTACATGCTGTGGCGCTATAATGA
TTGCTGCGTCAGGTATATACCCAACTAA
 Primer design