SecReT4
Protein ID: 18466507
T4SS name [ID]Tra_F [578]
Gene symboltrhN
Locus tagHCM1.101
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]73921..77097 [+]
Productconjugal transfer protein TraN
Component typeTraN_F
UniProt IDQ9RGV8
KEGG IDsty:HCM1.101
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 5.6e-24, Aligned region: 541..710
TraN [PF06986], Evalue: 5.6e-24, Aligned region: 868..935
Protein Sequence: 1058 a.a.     [Download]
>gi|18466507|ref|NP_569315.1| conjugal transfer mating pair stabilization protein TraN [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MKHRKIISSAIIASMIANTMSWAFYVSLINIALTPKIFAADAIFDQLENNFNLANPNANRNATTSAQDIV
EKYKNADSGENLSGKISEKYVGKAESTNLNVGKYGTPNSNESVMSNAVSDGKSIGKAVQLPSMSGGTINS
NYTKEGAKLLSRDSSGNIGISNNPNTTAGTKTSTGELFSSEQKHSDVQFNAGGRYGDENGFINDIKNRKS
QLFEAQSYDGVAYRTLVNANKENPASTIKPNDPMFNAGRNEIGNAVAGTGNWLQNCNTETSKQTITTHYP
DYKEFYCNSPKKDNFNSCTITRDFSVPVYISGGNGDMSMCGDNCVRVWFGRRDDNYWNDGVYDNSLTLKF
HPDAKLATAKIINAEWDDHMRVTLDGTQIFAHIDGAYRSSNYPSPQGQWELKKSWKLDKVYDITEQVKTS
VYQEQDREVTMASRVWVGGGGEGYFEVEMTFENMKLEDKHIQEPAGCFDAVQTPNSFCRFDRFVNMDVGT
KRLPESVLKMATPLYKGDTGYLTWKTNLEGYFCDPLAKEKLCSYDAKGNIMKDPTGKDLCYNYDDIKNMP
DACSTYKNDAACVLDNQTCAEGWFDEGTNTCYMYEQKYTCDRGKDVVREVESQTNSCVGMIPCSGGTCET
GPKEENKDFGKVAAYSNMVQYMQGEAKCEDPNDPNSCSVFEGKAEWCGRSVGFVNGLAKTDCCEKPQGAA
GSLEAIMLAGSMIRNTNWTRVNAQLVNWTGGESGTWASMANSVGEWTASAGKTVGQMWNNVTSSITSVYE
NVAGNLGRTVGSSAAGESGQLAKETMSSFGLGKLKQMAMEKAYDLLPDTVRDFVFKNVATTGGEIVFSAA
VQNFMLALNVIGWIYTAYQVTKMLLEMLVACDQKEMEASIHKNQKSCFTLDTNRCVKYLNLGFTKKCVKK
ATDMCCYNSMLSRVIMQQAYPQLGIDPVTSNCVGLSIGQIQKLDFDKIDLTEWINDAVQVGEVPDQYATF
SESSITANLPFKNENYQLPSERTKDAMGGEENMIKARQENAQAIKEENVDCSYLPRPAICEVGSTYVDPI
TGKEIPKY
 
Nucleotide Sequence: 3177 bp     [Download]
>gi|18466424|ref|NC_003384.1|:73921-77097 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGAAACATAGAAAAATAATTTCTTCAGCAATTATTGCGTCTATGATAGCTAATACTATGAGTTGGGCAT
TTTACGTTTCGCTCATAAACATTGCGTTAACGCCTAAAATATTTGCGGCAGATGCGATTTTTGACCAGCT
TGAAAACAATTTTAACCTTGCCAATCCCAACGCCAACCGGAACGCAACCACCAGTGCTCAGGATATTGTG
GAAAAGTATAAAAATGCTGATTCCGGGGAAAATCTGAGCGGCAAAATTTCCGAGAAATATGTTGGTAAAG
CAGAGTCAACAAACCTAAATGTTGGGAAGTACGGGACGCCGAACTCAAATGAAAGTGTTATGAGTAATGC
GGTGTCCGACGGGAAATCGATCGGTAAGGCTGTACAATTACCTAGCATGTCGGGCGGTACAATTAACTCG
AATTATACGAAAGAGGGGGCAAAGTTACTTTCTAGGGACAGCAGCGGTAATATTGGAATAAGTAACAACC
CGAATACAACGGCAGGTACCAAAACCAGTACAGGGGAACTATTCAGCTCAGAGCAGAAGCACAGTGATGT
TCAGTTCAATGCTGGTGGCCGGTATGGAGATGAAAATGGCTTCATCAATGACATCAAAAATCGAAAAAGT
CAGCTGTTTGAAGCGCAAAGTTATGATGGAGTCGCCTACCGTACTCTGGTGAATGCAAATAAAGAAAACC
CAGCATCTACTATTAAACCTAACGACCCTATGTTCAATGCGGGTCGTAACGAAATAGGAAATGCTGTAGC
TGGTACAGGAAACTGGCTACAGAATTGTAATACGGAAACATCAAAACAAACAATTACTACGCACTATCCA
GATTACAAAGAGTTTTACTGCAATTCACCCAAGAAAGATAATTTTAACAGTTGCACGATAACTCGTGATT
TTTCCGTGCCGGTTTATATCTCAGGTGGTAATGGTGATATGTCCATGTGCGGAGATAATTGTGTGAGAGT
CTGGTTTGGCAGAAGGGACGACAACTATTGGAACGATGGAGTCTATGACAACTCATTAACCTTAAAATTC
CATCCAGATGCAAAGCTCGCAACTGCGAAAATAATTAACGCAGAGTGGGATGACCATATGAGGGTCACGC
TTGATGGTACACAGATTTTTGCTCATATAGATGGAGCATATAGAAGTAGCAATTATCCATCTCCACAAGG
TCAATGGGAGTTAAAGAAATCCTGGAAGCTCGATAAAGTCTACGATATTACTGAACAAGTAAAAACCTCT
GTATATCAGGAGCAGGATCGTGAAGTGACTATGGCTTCGCGCGTATGGGTTGGCGGTGGTGGGGAAGGCT
ATTTTGAAGTTGAGATGACTTTTGAAAATATGAAGTTGGAGGATAAACATATACAGGAGCCCGCAGGATG
TTTTGATGCAGTACAAACGCCGAATTCATTCTGTCGGTTTGACAGGTTTGTCAACATGGATGTTGGTACA
AAGCGACTCCCGGAAAGTGTGCTTAAGATGGCCACACCGCTTTACAAAGGTGATACAGGATACTTAACCT
GGAAAACAAACCTTGAAGGCTATTTCTGTGATCCCCTGGCGAAGGAAAAACTGTGCTCTTATGATGCGAA
GGGAAACATCATGAAAGACCCCACAGGCAAAGACCTTTGCTACAACTACGACGATATAAAAAATATGCCT
GACGCATGCAGCACATATAAAAATGATGCTGCGTGTGTGCTAGATAATCAGACATGTGCTGAAGGTTGGT
TCGATGAAGGCACAAATACTTGCTACATGTATGAGCAGAAATATACATGTGACAGAGGGAAAGACGTAGT
CAGAGAGGTAGAGTCACAGACTAACTCCTGTGTAGGTATGATCCCATGTTCTGGCGGAACATGTGAAACA
GGCCCAAAAGAAGAAAACAAAGATTTTGGGAAAGTGGCCGCGTACTCCAATATGGTTCAGTACATGCAAG
GTGAAGCAAAATGCGAAGATCCAAACGACCCTAACTCCTGCTCTGTCTTTGAAGGGAAAGCAGAGTGGTG
CGGCAGGTCCGTTGGTTTTGTGAACGGACTGGCCAAAACAGATTGCTGCGAAAAGCCGCAGGGTGCTGCT
GGGTCACTGGAGGCGATAATGCTGGCCGGGTCGATGATCCGAAACACGAACTGGACCCGAGTGAATGCTC
AACTGGTAAACTGGACTGGAGGGGAGAGCGGAACCTGGGCATCAATGGCTAACTCAGTGGGTGAATGGAC
TGCATCGGCAGGTAAAACTGTCGGACAAATGTGGAACAATGTGACCAGTTCAATAACCAGCGTTTACGAA
AACGTGGCCGGTAACCTTGGCCGAACAGTAGGATCATCCGCTGCTGGTGAAAGTGGTCAGCTTGCTAAGG
AGACTATGAGTTCATTCGGGCTTGGTAAACTTAAGCAGATGGCCATGGAAAAAGCCTATGACCTGCTTCC
CGATACAGTTCGAGACTTCGTATTTAAAAATGTAGCGACAACGGGTGGAGAAATAGTCTTTTCTGCTGCT
GTTCAAAACTTTATGCTTGCATTAAATGTAATCGGCTGGATTTATACGGCATATCAAGTCACAAAAATGC
TGCTTGAAATGCTGGTGGCCTGCGATCAAAAAGAAATGGAAGCATCTATTCACAAAAATCAGAAATCCTG
TTTTACACTGGATACAAACCGTTGTGTTAAATATCTGAATCTGGGATTTACAAAGAAATGTGTTAAAAAA
GCAACAGACATGTGCTGTTACAATTCAATGTTATCTCGCGTTATTATGCAGCAGGCCTACCCGCAGCTTG
GAATAGACCCGGTTACTTCAAACTGCGTTGGCTTATCAATAGGGCAGATCCAAAAGTTAGATTTTGACAA
GATTGATTTAACAGAATGGATTAACGATGCTGTTCAGGTCGGAGAAGTACCGGACCAGTACGCTACATTC
TCAGAATCGTCAATAACAGCAAATTTGCCATTTAAAAACGAGAATTATCAACTTCCATCAGAAAGAACAA
AAGATGCAATGGGAGGAGAGGAGAATATGATAAAAGCCAGACAGGAAAACGCTCAGGCCATTAAAGAGGA
GAACGTAGACTGTAGCTATCTTCCACGCCCTGCGATTTGTGAAGTTGGGTCAACTTATGTAGATCCAATT
ACAGGTAAGGAAATACCAAAATATTAA
 Primer design