SecReT4
Protein ID: 18466637
T4SS name [ID]Tra_F [578]
Gene symbol-
Locus tagHCM1.259
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]190873..191388 [+]
Producthypothetical protein
Component typeOrf169_F
UniProt IDQ9L5L2
KEGG IDsty:HCM1.259
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 171 a.a.     [Download]
>gi|18466637|ref|NP_569445.1| hypothetical protein HCM1.259 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MFIPPVDDVKPIPVPVEIYTQCITDASRFFGIDAELVFTLFDNEGGKVGTFSRNKNGTYDIGPMQINSSN
LPEIRDHFPSVTWRVLAYDACASFWVGTWWLYRKIVDRKGNVFEGIADYNSKTPKVRATYIFNFMIKYNR
RIQRRNGMDELYQWTQPKPQYNGHIVKNLPE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|18466424|ref|NC_003384.1|:190873-191388 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
GTGTTTATACCACCAGTAGACGATGTGAAACCTATTCCCGTTCCTGTTGAGATCTACACGCAGTGCATTA
CCGATGCCTCCCGTTTTTTCGGGATTGATGCGGAGTTGGTCTTTACGCTTTTTGATAATGAGGGCGGAAA
AGTCGGGACGTTCAGCCGTAATAAAAATGGCACTTATGATATTGGGCCTATGCAGATCAATTCGTCCAAC
CTGCCAGAAATACGCGACCATTTTCCGTCTGTTACGTGGCGGGTGCTGGCCTATGACGCCTGTGCCAGTT
TCTGGGTGGGCACCTGGTGGCTTTACCGGAAGATTGTTGACCGGAAGGGTAACGTATTTGAAGGGATTGC
CGATTACAACAGCAAAACCCCTAAGGTCCGGGCGACGTATATCTTCAACTTCATGATCAAATACAATCGC
CGGATTCAGCGCCGAAATGGAATGGACGAATTATATCAGTGGACGCAACCTAAGCCCCAGTACAACGGGC
ATATTGTAAAAAATCTTCCTGAATAA
 Primer design