SecReT4
Protein ID: 18466639
T4SS name [ID]Tra_F [578]
Gene symbol-
Locus tagHCM1.262
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]192297..196286 [-]
Producthypothetical protein
Component typeTraG_F
UniProt IDQ935H1
KEGG IDsty:HCM1.262
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 5.3e-82, Aligned region: 4..500
Protein Sequence: 1329 a.a.     [Download]
>gi|18466639|ref|NP_569447.1| hypothetical protein HCM1.262 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MDYNIYTVGDIEFVWSALNGIALIFSQYTGVKAFLTTAAVLAGASLFYKTWLWLLNPTKAEVPIFSWILG
LILFSMAIVRVDVTIESVKSGEVRNVDGIPIFIAAMGTVTTNLSQGLLKDYKTAFDPLAPIDFAATTLDD
DITLGPMIRFVKFLQWGGDSQGYCSAFPEPASGLGAMNVCATVQSLAYNCLKGTQNSSAKIAGKETIFND
IFSANIVDSMERINQAMKGSLKNASANIVGVNSSKSATCEEVWSTVKQVTSTPEARQTIALIGQTNGILA
PDEAGGAASGASFTDVMASANGMYGKAIGAYDATLSLFIMNELRNGASKYKTPLGLASDMQLFEASLKRT
NTMASQGQLWLQLSGAAIAFLEMFAYMVAPFALLMLLALGGNGVAAAAKYLQLILFVNMWPITAVMVNAY
VKKVATADLDTWSTLNSQSNAVTWMGLPGLAETYSSYLSVASALYALIPVLTLFLMTQSIHPMMNAMKGV
TPPAPVDSSHLTPKVWDAPNSGKSSFGDVNRTALTSTGQGFSGGGAMDSSNFRLGTWNAGSSIASSQGQG
AAFTSSAMSAASNTFQQAFNQMSEVGRTGQSGQQFTSNLQSLKSFTDQAGANIANSVGAKHGINSQQLAG
VVSNLLLNGSLGLGGEEKLGKGGGGGLAQKVMDSLGIKAEGQVGSGITKSNSGNESLLTDLSKAITTQLT
ENSGLTDQMTKAAAQINSDQFAQTNAFKEAATKMNQSTQTMAENLSTSLSTNASANTGMTLDSRQAINLD
RFSDSIRNKNFSDEDVRNFARKNGLDENAFMEKFNSYNDTFKASTQLGSQLQRTDALVATTRDFSEQKIA
IDTARGETAESNKQDLRETSSLLKGLVADFGGNAQQMLPITNQLDRITGDASGINTIAQAQDRTPEHVNT
SSVMSADRVADVGQSMDAQAKAGLVQNQQNANQHVGGQTESGVTPYNVDKISKEDIQGIHQGNVNKSYSE
ENQNVLSSLEKNTPVVTNETVGRVQGAGVDVQHANQTFDQLQAGSGGKHATSGMGTISDKLNNMYGDNQI
RGISGNLPNYFGRIANDPTKKPDDKRAELAAQAVFTYGASTMATGAEKEQLKADTQNILSELSHYNVRWG
MNDLQNIHEGFNMHNKASGSLDSVVRANLGEGGSGGGLVGQRTQTTTDLLVGNKIESNTERGVIGSTLLS
GQESVARGLDVIGAKPVNDMLSGMGILTTPSSLANDASNPQNMPSSLLGKVGNHLQMSDGVSEVTSRYKD
MGGDGIKAYETASQNSERAIRQQLTDDPRFGPDKADAFVSFMKSNLNNTNEPYQSRIEKAKSWLNENKK
 
Nucleotide Sequence: 3990 bp     [Download]
>gi|18466424|ref|NC_003384.1|:c196286-192297 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGGATTACAACATCTATACAGTTGGCGATATTGAATTTGTGTGGTCCGCCCTGAACGGGATTGCCCTGA
TTTTCTCACAATACACCGGTGTAAAAGCATTTCTAACGACGGCAGCGGTACTGGCTGGAGCCAGCCTGTT
TTATAAAACGTGGCTTTGGCTGTTGAACCCGACAAAAGCAGAAGTGCCGATATTTTCATGGATTCTTGGG
CTGATTCTATTTTCGATGGCAATTGTTCGTGTGGATGTGACGATTGAATCAGTTAAGTCTGGTGAAGTGA
GAAATGTCGATGGCATTCCTATTTTTATTGCGGCGATGGGAACTGTCACCACGAACCTTAGCCAGGGCTT
ACTCAAAGACTACAAAACGGCATTTGATCCACTGGCGCCGATCGACTTTGCCGCAACGACGCTTGATGAT
GACATTACTCTTGGTCCGATGATTCGTTTCGTTAAATTCTTACAATGGGGTGGTGACAGCCAGGGCTATT
GTTCTGCGTTTCCCGAACCAGCCAGCGGGTTAGGTGCGATGAATGTGTGCGCGACAGTACAATCACTGGC
CTATAACTGTCTCAAGGGAACCCAAAACTCAAGCGCAAAAATTGCTGGGAAAGAAACCATTTTTAACGAT
ATTTTCTCTGCAAATATCGTGGATAGCATGGAACGCATTAATCAGGCGATGAAAGGTTCGCTGAAGAACG
CCTCTGCCAACATTGTCGGTGTGAATAGCTCAAAGTCTGCTACTTGTGAAGAGGTCTGGTCGACCGTTAA
ACAGGTAACGAGCACCCCAGAGGCTCGGCAGACGATTGCATTGATTGGGCAAACAAACGGTATCCTTGCT
CCAGATGAGGCGGGAGGTGCAGCATCAGGAGCGAGCTTCACGGATGTAATGGCGTCGGCGAATGGCATGT
ACGGCAAAGCTATTGGTGCTTATGACGCGACGCTTAGTTTGTTCATCATGAATGAACTCCGTAATGGTGC
CAGCAAGTACAAAACCCCACTCGGGCTGGCCTCGGATATGCAGTTGTTTGAGGCATCATTAAAGCGTACG
AATACCATGGCATCTCAGGGGCAGCTCTGGCTGCAATTGTCCGGTGCAGCCATCGCGTTTCTTGAGATGT
TTGCGTACATGGTTGCCCCATTTGCATTGCTCATGCTTTTGGCTCTCGGGGGAAATGGTGTGGCCGCTGC
TGCAAAATATCTCCAGCTTATTCTTTTCGTAAATATGTGGCCTATTACTGCGGTTATGGTGAATGCCTAC
GTGAAGAAAGTGGCGACCGCAGATCTTGATACATGGAGCACATTGAATAGTCAGAGTAACGCGGTGACAT
GGATGGGTTTGCCAGGGCTTGCCGAAACATACAGCTCTTATTTATCAGTAGCATCAGCACTCTATGCTCT
TATCCCTGTATTGACGCTGTTCCTGATGACGCAATCCATTCATCCAATGATGAACGCGATGAAAGGAGTC
ACACCACCAGCGCCAGTGGACTCCAGCCACCTCACGCCGAAAGTGTGGGATGCGCCAAACAGCGGAAAAT
CATCGTTTGGGGATGTGAATCGTACCGCGCTGACAAGCACCGGCCAAGGATTCAGTGGTGGCGGGGCCAT
GGACTCCAGTAATTTCCGACTCGGTACGTGGAATGCCGGTTCAAGTATCGCGTCAAGCCAGGGGCAAGGG
GCAGCATTTACCTCTTCAGCCATGAGCGCAGCAAGTAACACATTCCAGCAGGCCTTCAACCAGATGAGTG
AAGTTGGCCGAACGGGGCAATCAGGCCAGCAATTTACCTCCAACCTGCAAAGCTTGAAATCATTTACTGA
CCAGGCCGGTGCAAACATCGCGAATAGCGTAGGGGCGAAGCATGGAATTAATTCGCAGCAATTAGCTGGC
GTGGTGTCAAATCTTCTGCTCAATGGCAGTTTGGGACTTGGTGGTGAAGAAAAACTTGGAAAAGGAGGAG
GAGGAGGTCTCGCTCAGAAAGTAATGGATAGCCTAGGAATAAAAGCGGAGGGGCAAGTTGGATCAGGGAT
CACGAAAAGTAATTCTGGGAATGAAAGTCTCTTAACTGATTTGAGTAAAGCTATTACGACTCAATTGACT
GAAAACTCAGGACTGACTGACCAAATGACTAAAGCGGCTGCTCAGATAAACAGTGATCAGTTTGCACAGA
CCAATGCATTCAAAGAAGCTGCAACAAAAATGAACCAGTCCACACAGACAATGGCCGAAAACTTGTCGAC
GTCACTTTCAACGAACGCCAGCGCCAATACTGGCATGACACTCGACTCAAGACAGGCTATCAACCTGGAC
AGATTCTCCGATTCTATCCGTAATAAAAACTTTAGCGATGAAGATGTGCGTAATTTTGCACGGAAAAATG
GTCTTGATGAGAATGCCTTTATGGAGAAGTTCAATTCCTATAATGACACATTTAAGGCCAGCACTCAGTT
GGGTTCACAACTCCAACGTACAGATGCGCTGGTGGCAACGACACGTGACTTTAGTGAGCAAAAAATAGCG
ATTGATACTGCCCGAGGTGAAACGGCTGAGAGCAATAAACAGGATCTGCGTGAAACTTCCAGCCTGCTTA
AAGGGCTGGTTGCTGACTTTGGCGGTAACGCTCAACAGATGCTGCCGATTACTAATCAGCTTGACCGAAT
CACTGGTGATGCCTCGGGTATTAACACGATTGCACAGGCGCAGGATCGCACCCCAGAACATGTAAATACG
TCCAGCGTAATGAGCGCTGATCGTGTTGCTGACGTGGGGCAAAGTATGGATGCTCAGGCAAAAGCCGGGC
TGGTACAAAACCAACAAAATGCTAACCAGCATGTTGGTGGACAAACTGAGTCTGGTGTAACTCCGTACAA
TGTGGACAAGATCAGCAAAGAAGATATTCAGGGCATTCATCAAGGTAATGTAAATAAATCCTATAGCGAA
GAGAACCAGAATGTGCTCTCGTCATTGGAGAAGAATACCCCTGTTGTGACGAATGAAACTGTGGGAAGAG
TTCAGGGGGCTGGGGTGGACGTTCAGCACGCCAACCAAACTTTCGACCAGTTACAGGCTGGTTCGGGCGG
TAAGCATGCGACTTCGGGCATGGGTACTATCAGCGACAAACTGAATAATATGTACGGAGATAACCAGATA
CGCGGTATATCAGGCAACCTCCCGAATTATTTTGGCAGGATTGCAAATGATCCTACCAAAAAGCCGGATG
ACAAACGTGCGGAACTGGCCGCACAAGCTGTGTTTACCTATGGCGCCAGTACAATGGCAACCGGCGCTGA
GAAAGAACAACTGAAAGCGGATACTCAAAATATCCTCTCCGAACTGAGTCACTATAACGTTCGCTGGGGG
ATGAACGATCTCCAGAATATCCATGAAGGTTTCAACATGCATAACAAGGCTTCAGGTTCTCTTGACTCAG
TTGTGAGGGCGAATCTTGGGGAAGGTGGTTCTGGCGGCGGGCTCGTTGGGCAACGAACCCAAACCACGAC
GGATCTCCTTGTTGGTAATAAAATTGAGTCCAATACAGAACGTGGTGTTATTGGTAGTACGCTTTTATCG
GGGCAGGAGAGTGTTGCCAGAGGACTTGACGTTATCGGAGCTAAACCTGTAAACGACATGCTCTCAGGTA
TGGGTATCCTGACCACCCCTTCATCTTTGGCAAACGATGCTTCGAATCCACAAAATATGCCGAGCTCGCT
ATTGGGCAAGGTTGGAAATCACCTGCAAATGTCAGATGGTGTTAGCGAGGTGACCAGCAGGTATAAGGAT
ATGGGGGGGGATGGGATCAAGGCGTATGAGACTGCATCACAAAACTCAGAACGTGCGATTCGTCAGCAAC
TGACCGATGATCCACGTTTTGGGCCGGATAAAGCAGATGCATTCGTGAGCTTTATGAAGTCAAACCTGAA
TAATACAAATGAACCATATCAGTCGAGAATTGAGAAAGCTAAAAGCTGGCTGAATGAAAATAAGAAGTAA
 Primer design