SecReT4
Protein ID: 18466640
T4SS name [ID]Tra_F [578]
Gene symbol-
Locus tagHCM1.263c
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]196295..197710 [-]
Productpilus assembly protein
Component typeTraH_F
UniProt IDQ9L5L5
KEGG IDsty:HCM1.263c
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 8e-90, Aligned region: 33..398
Protein Sequence: 471 a.a.     [Download]
>gi|18466640|ref|NP_569448.1| pilus assembly protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MRADFHVCAKKLLLSLAVCTAMIAPNAVADNAMRNIFNGMMTTTSPASFETATRTGVVGGSFSYRTTNVN
TNLVSMSFPKASVGCNGIDVFLGSFSMINGDQLVQVARGIAQGAAIYAFNVAVSAICADCAATINDIQNK
LQALNKFAKDSCNATYSFLTENVGPPSQFANAVSSGPASMLGTLNGLLPDFGSSMTKSPETVTSQVKAKD
PEEFAEKFSGNLFYMSFMDIDKGSMNIGGVTELSGYRLAEQLMSLVGTVIINWDAKGEKAGMEVRPSTMT
VSDFIMGPPAGGSIKMLKCSPAPDPASARKSQCLVMSEVTDGGFKGLKDTISDLLIQVQTKAISDVRISD
DELRIISYIGIPTILDSLQTFDVPEGYAYIQDISAIAATSLVINMLRQVEAKISAMNIPSESLSGRRQDL
TRLSENLTNQVKAAYELTRSQVGNSSDVISAWDDRRLKRKAFMESLRGTGN
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|18466424|ref|NC_003384.1|:c197710-196295 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGCGCGCTGATTTCCATGTTTGTGCAAAAAAGTTACTTTTATCGTTAGCCGTTTGCACGGCGATGATTG
CGCCAAATGCCGTTGCCGATAACGCCATGCGTAATATTTTCAATGGCATGATGACGACTACGAGCCCAGC
TAGTTTTGAAACGGCCACCCGTACCGGAGTGGTTGGCGGCTCATTTTCCTACCGCACGACAAACGTGAAT
ACCAATTTAGTGTCAATGTCTTTTCCCAAAGCTTCCGTAGGCTGCAACGGAATCGATGTTTTCCTTGGTT
CCTTCAGTATGATTAACGGAGATCAGCTGGTTCAGGTTGCTCGCGGTATTGCACAGGGGGCTGCAATTTA
TGCATTCAATGTCGCGGTATCGGCAATCTGTGCTGACTGTGCTGCGACTATTAACGATATCCAGAATAAA
TTGCAGGCGCTGAATAAATTTGCCAAAGATTCATGCAACGCTACTTATTCGTTTCTTACTGAAAATGTTG
GTCCACCTAGCCAGTTTGCGAATGCTGTCAGTTCCGGCCCTGCTTCAATGCTTGGCACTCTTAATGGACT
GTTGCCTGATTTTGGTTCATCAATGACAAAGTCGCCGGAAACCGTGACTTCCCAGGTAAAAGCAAAAGAC
CCTGAAGAGTTTGCTGAAAAATTCAGTGGAAACCTTTTCTATATGTCATTTATGGACATCGATAAAGGGT
CAATGAATATCGGTGGCGTGACTGAGCTATCTGGCTACAGACTTGCTGAGCAGCTGATGTCGCTTGTCGG
TACTGTAATTATCAACTGGGACGCTAAAGGTGAAAAAGCGGGGATGGAAGTTCGCCCGTCGACGATGACG
GTATCGGATTTCATCATGGGCCCACCGGCTGGTGGTTCCATAAAAATGCTCAAATGTTCGCCTGCCCCCG
ATCCAGCTTCAGCTAGAAAGTCGCAATGCCTGGTTATGTCTGAAGTGACGGATGGTGGTTTCAAAGGTTT
GAAGGATACAATCTCGGACCTCCTTATTCAGGTTCAGACAAAGGCAATTAGTGATGTCAGGATCTCTGAT
GATGAATTACGCATTATTTCTTATATTGGCATCCCAACTATTCTTGATTCACTTCAGACGTTTGATGTCC
CTGAAGGCTACGCCTATATCCAGGATATCAGTGCGATAGCGGCCACCAGCCTTGTTATTAACATGCTTCG
GCAAGTTGAAGCAAAGATCAGCGCTATGAATATACCCAGCGAATCTCTTTCCGGGCGGCGGCAGGACCTG
ACTAGGTTATCTGAAAACCTGACCAATCAGGTAAAAGCTGCCTATGAGCTAACCCGTAGCCAGGTGGGCA
ACAGCTCTGACGTCATTTCTGCATGGGATGATCGCCGATTAAAGAGAAAAGCGTTCATGGAAAGTCTTCG
TGGCACAGGTAACTGA
 Primer design