SecReT4
Protein ID: 18466641
T4SS name [ID]Tra_F [578]
Gene symbol-
Locus tagHCM1.264c
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]197700..198746 [-]
Productpilus assembly protein
Component typeTraF_F
UniProt IDQ9L5L6
KEGG IDsty:HCM1.264c
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.9e-49, Aligned region: 45..267
Thioredoxin_2 [PF13098], Evalue: 2.5e-07, Aligned region: 174..265
Protein Sequence: 348 a.a.     [Download]
>gi|18466641|ref|NP_569449.1| pilus assembly protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MTRLTLIPSKMLVLLSLFITGVHANEEQALIKDTPFVSGQAFKKGFFWYDDPTRKTEEEITETKPPVASS
TQPEQEEKIELNSKWLKDNMPQLLTKAMDNPTPENLSRFYTAQRLMLDIGTRFSDKSKDYFLKNPMMSEK
RRQPVEKVALDAHRTVVEKNQQSVMKDIFTKSGLFFFFQSTCQFCHEESQILQFMENYYSVDILPVSMDG
RPLQNGLFQDFSVPNAQIIDQFKIREVPTIFLVSKDGSSAQRISEGMITAEELKNTIILAAKGMKLIDDA
SFQSTLDIKRQYTIGEDGVITVNKSEMDSDPFLLQRIMDKKLEGYDMPTADPVNYLNVGGSLGGAYAR
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|18466424|ref|NC_003384.1|:c198746-197700 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGACTCGATTAACGTTAATACCTTCAAAGATGTTAGTGCTGCTGTCTTTGTTTATTACTGGGGTCCATG
CAAATGAAGAGCAGGCCCTTATCAAAGACACTCCCTTTGTATCAGGACAGGCCTTCAAGAAAGGCTTTTT
CTGGTATGACGACCCGACAAGGAAAACTGAGGAAGAAATTACAGAGACCAAGCCTCCTGTTGCATCTTCG
ACCCAGCCAGAACAAGAAGAAAAGATTGAGCTTAATTCAAAGTGGCTAAAGGACAATATGCCTCAGCTTT
TGACTAAGGCTATGGATAATCCGACCCCTGAAAATTTATCGAGATTTTATACAGCACAACGTTTAATGCT
GGATATCGGTACGCGGTTTTCGGATAAATCGAAAGATTATTTCCTTAAAAATCCAATGATGTCTGAAAAA
CGCAGGCAACCGGTTGAAAAGGTAGCGCTCGATGCACATCGTACGGTGGTCGAGAAAAATCAGCAGTCGG
TTATGAAAGATATTTTCACTAAATCCGGGCTGTTTTTCTTTTTCCAGAGTACTTGTCAGTTCTGCCACGA
AGAAAGTCAAATACTCCAGTTTATGGAGAATTACTATTCTGTCGACATTCTTCCTGTCAGCATGGACGGC
AGACCACTACAGAATGGGTTGTTCCAGGATTTCTCTGTACCTAATGCGCAGATTATTGATCAATTTAAAA
TCCGTGAAGTTCCAACTATTTTCCTTGTCTCAAAAGATGGGTCATCAGCGCAACGAATAAGCGAAGGCAT
GATCACTGCTGAGGAGCTCAAGAATACTATTATTCTGGCTGCAAAAGGCATGAAGCTGATTGATGATGCC
TCTTTCCAGTCCACTTTAGATATTAAGCGCCAATATACCATTGGCGAGGATGGCGTAATTACTGTGAATA
AATCAGAAATGGACTCTGACCCGTTCTTATTGCAACGAATAATGGATAAGAAACTGGAAGGGTACGATAT
GCCAACGGCGGACCCAGTGAACTATCTGAATGTGGGTGGAAGTTTAGGAGGTGCATATGCGCGCTGA
 Primer design