SecReT4
Protein ID: 186474537
T4SS name [ID]VirB [206]
Gene symbol-
Locus tagBphy_7522
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY02 [GenBank: NC_010627] [Browse all T4SS(s) in this replicon]
Location [Strand]295438..297243 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDB2JXV0
KEGG IDbph:Bphy_7522
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.4e-95, Aligned region: 13..444
TraG-D_C [PF12696], Evalue: 3.2e-23, Aligned region: 289..408
TrwB_AAD_bind [PF10412], Evalue: 1.2e-12, Aligned region: 266..423
Protein Sequence: 601 a.a.     [Download]
>gi|186474537|ref|YP_001863508.1| TRAG family protein [Burkholderia phymatum STM815]
MSHTYPPFIVGKFKGEYLKYRGQDFLMLAAGTRSGKGVSMVIPNLLTYPDSVVVEDIKEENFMYTSGYRR
KCGHEVYLWSPFSENGRSHAYNPLEYIAGRPAYTRVGDVMTIGEHLYPSNVDARLRYWNDNARNLFIGIV
LYLLETPSLPCTFGEVLRQASGKGRAIREHVSSIVSTRANATDTLPALSFECLDALNRFLSQSREAFANI
VSTMTAPLNVFSNPVVDAATSRSDFHLGEVRKKRISIYVGIKPGDLKAGALLVNLFFSQLIDLNTREQPA
ENPELKYQCALMMDEFAAPGKIDIIDTANAFIAGFNLRLMLIFHGMSQLEDPKLYGRHGAETLAINCKMR
SLFAPRTLKDSEEYSKMLGTFTHLSRSRSRSRGRSASTSTNETEHGRPLMLPQELRALSSRKQIITIDGC
EPILCDKAYFYEDAELVDRLVQQSPYLLGVMASLEKTNRRRAWFGFGPKFPNEEQMKHAAFVARELSAPV
PQIDVEQWWHSQNAARRAQVEPAAGAAETAGVRDVREHEIGVLCAGHFTNRGSIRAALFRLMPYLSEVLP
DGAASARADTASSQAALQTGSHSDSPAAPQPDQQPEQGVVA
 
Nucleotide Sequence: 1806 bp     [Download]
>gi|186474323|ref|NC_010627.1|:c297243-295438 Burkholderia phymatum STM815 plasmid pBPHY02, complete sequence
ATGTCCCACACGTATCCACCATTCATCGTCGGCAAATTCAAGGGCGAGTATCTGAAGTATCGCGGCCAGG
ACTTCCTCATGCTTGCCGCCGGCACGCGCTCGGGCAAAGGCGTCTCGATGGTGATCCCGAATCTTCTCAC
CTATCCCGATTCGGTCGTCGTCGAGGACATCAAGGAAGAGAACTTCATGTACACGTCCGGCTACCGCAGG
AAGTGCGGTCACGAGGTCTACCTGTGGTCACCGTTTTCCGAAAATGGCCGCTCGCACGCATACAACCCGC
TCGAGTACATCGCTGGCCGACCGGCCTATACGCGCGTGGGTGACGTGATGACGATCGGCGAGCATCTGTA
TCCGTCGAATGTCGACGCGCGCCTGAGGTACTGGAATGACAACGCCCGCAACCTGTTCATTGGGATCGTG
CTGTACCTCCTTGAAACGCCGTCGCTGCCGTGCACGTTCGGCGAAGTGTTGCGGCAGGCCTCCGGCAAGG
GCCGCGCGATTCGCGAGCATGTCTCGTCGATCGTCAGTACGCGCGCGAATGCCACCGACACGCTGCCTGC
CCTGAGCTTCGAGTGTCTGGACGCGCTCAACCGCTTTCTGTCGCAGTCGAGGGAAGCGTTTGCCAATATT
GTGTCGACGATGACGGCGCCGCTAAACGTGTTCAGCAATCCCGTCGTCGATGCGGCGACGAGCCGTTCTG
ATTTTCATCTGGGCGAGGTACGAAAGAAGCGCATATCCATCTATGTTGGTATCAAGCCGGGAGACCTGAA
GGCGGGCGCGCTGCTCGTCAATCTCTTCTTCTCACAGCTGATCGACCTGAACACGCGTGAGCAGCCTGCC
GAGAATCCGGAGCTCAAGTACCAGTGCGCGCTGATGATGGATGAGTTTGCGGCACCGGGAAAGATCGACA
TCATCGATACGGCCAACGCGTTCATCGCCGGCTTCAACCTGCGGCTCATGCTGATTTTCCACGGCATGTC
GCAGCTCGAGGATCCGAAGCTGTACGGCAGGCACGGTGCGGAAACACTGGCGATCAACTGCAAGATGCGT
AGCCTCTTCGCGCCGCGCACGCTGAAGGACTCGGAAGAGTATTCGAAGATGCTGGGCACGTTCACGCATC
TGTCGCGCTCTCGCAGCCGCAGCCGCGGCCGCAGCGCGTCCACGAGTACGAACGAGACCGAGCACGGCCG
GCCGCTGATGCTGCCGCAGGAACTGCGAGCCCTGTCCAGCCGCAAGCAGATCATCACGATCGACGGTTGC
GAACCGATCCTGTGCGACAAGGCGTACTTCTACGAGGATGCCGAGCTCGTCGACCGCCTGGTCCAGCAGA
GTCCCTACCTGCTGGGGGTGATGGCCAGTCTCGAAAAGACGAACCGTCGCCGTGCATGGTTCGGGTTCGG
ACCGAAGTTCCCGAACGAGGAGCAGATGAAGCACGCCGCGTTTGTTGCGCGCGAACTCAGTGCGCCCGTG
CCGCAGATTGATGTCGAGCAGTGGTGGCACTCGCAGAATGCCGCGCGTCGCGCCCAGGTTGAGCCTGCAG
CGGGCGCGGCAGAGACAGCCGGGGTGCGCGATGTCCGCGAACATGAAATTGGCGTGCTCTGCGCCGGGCA
CTTCACCAACCGCGGCAGTATCCGCGCCGCGCTGTTCCGGCTCATGCCGTACCTGAGCGAGGTGCTGCCC
GATGGGGCCGCTTCGGCACGGGCGGACACAGCCAGTTCACAAGCCGCGTTGCAGACCGGTTCGCACTCCG
ATTCGCCAGCCGCCCCGCAACCTGATCAGCAGCCTGAACAAGGAGTTGTCGCATGA
 Primer design