SecReT4
Protein ID: 186474541
T4SS name [ID]VirB [206]
Gene symbol-
Locus tagBphy_7526
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY02 [GenBank: NC_010627] [Browse all T4SS(s) in this replicon]
Location [Strand]299202..300239 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB2JXV4
KEGG IDbph:Bphy_7526
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.1e-55, Aligned region: 29..321
Mg_chelatase [PF01078], Evalue: 2.5e-06, Aligned region: 156..218
Protein Sequence: 345 a.a.     [Download]
>gi|186474541|ref|YP_001863512.1| P-type DNA transfer ATPase VirB11 [Burkholderia phymatum STM815]
MNAVVIDVIEKGTIARSFLRQMGIASFFDGSLTEVAINRPGEIWTQGSAGWKRHEAPACTLDACFKLANA
LTVMKGGKFSTKEPIHPVALPDGQRAHVLMQPACEQDTISITIRIPSNQRFSVDEYERNGWFAGYRDMSP
RREAPASLDLQPFEQDMLQAQRQRNVTRLLELAVANRLNIVLAGGTGSGKTTLNKALSDLVPSDERIGTI
EDTPELSLPNHPNRVHMFFSDTLPAKELVRSTLRMKFDRVFLAELRGDETWDYMTLLNTGTPGGITTVHC
NDARSAHSRIATLIKQSVVGQTLDWRFIMDQVRVTIDLVLFMRDKRLSEIWYDPVGKWQLLGGIA
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|186474323|ref|NC_010627.1|:c300239-299202 Burkholderia phymatum STM815 plasmid pBPHY02, complete sequence
ATGAATGCAGTGGTTATCGATGTCATCGAAAAGGGCACCATCGCGCGCAGCTTCCTCCGGCAGATGGGTA
TCGCCAGTTTCTTTGACGGCAGTCTCACCGAGGTGGCCATTAACCGGCCCGGCGAAATATGGACACAGGG
ATCAGCCGGATGGAAGCGGCACGAGGCGCCCGCCTGCACACTCGACGCCTGCTTCAAGCTCGCCAACGCC
CTCACGGTGATGAAGGGTGGCAAGTTCTCGACGAAGGAACCGATTCACCCAGTGGCCCTTCCCGACGGCC
AGCGCGCTCACGTGCTGATGCAGCCTGCGTGCGAGCAGGACACGATTTCGATCACCATCCGGATTCCATC
GAACCAGCGGTTTTCCGTTGACGAATACGAACGCAACGGCTGGTTTGCAGGCTACCGGGACATGTCGCCG
CGCCGGGAGGCGCCGGCATCGCTCGACCTGCAGCCGTTCGAGCAGGACATGCTTCAGGCGCAGCGCCAGC
GCAACGTCACGCGCCTGCTTGAGCTCGCCGTCGCGAACCGCCTCAATATTGTGCTCGCCGGCGGCACCGG
CTCCGGCAAGACGACCCTCAACAAGGCCCTGTCCGATCTCGTGCCGTCTGATGAGCGGATTGGCACGATC
GAGGATACGCCGGAGCTGTCGCTGCCGAACCATCCGAACCGCGTGCACATGTTTTTCAGCGACACGCTGC
CCGCAAAGGAACTGGTGCGCTCGACGCTGCGCATGAAGTTCGATCGTGTGTTTCTTGCCGAGCTGCGTGG
CGACGAGACATGGGACTACATGACGCTGCTCAACACGGGTACGCCCGGCGGTATTACGACCGTTCACTGC
AACGACGCCAGGTCGGCCCATTCCCGTATCGCGACGCTGATCAAGCAGAGCGTGGTGGGTCAGACGCTCG
ACTGGCGATTCATCATGGATCAGGTCCGCGTGACCATCGATCTCGTGCTCTTCATGCGCGACAAGCGCCT
GTCGGAAATCTGGTACGACCCGGTGGGCAAATGGCAACTGCTGGGAGGCATCGCATGA
 Primer design