SecReT4
Protein ID: 186474545
T4SS name [ID]VirB [206]
Gene symbol-
Locus tagBphy_7530
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY02 [GenBank: NC_010627] [Browse all T4SS(s) in this replicon]
Location [Strand]303063..303914 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDB2JXV8
KEGG IDbph:Bphy_7530
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.8e-44, Aligned region: 50..259
Protein Sequence: 283 a.a.     [Download]
>gi|186474545|ref|YP_001863516.1| VirB8 family protein [Burkholderia phymatum STM815]
MVSVIRQWLAAGVGSRKRAPTPPISAAHLEAAARAVDRSQRDAVSWYLDQAREFERSKMEMAEEKARVAD
RRSVLSGGIALAAVFGITALGLLKRPNPPAVLRVNDTTGKVDVLPTTANGHVSFTEKTDRADLRRYVEMR
ESYDWETISDMHSAVMFMSDDREKDAYDALIRGPAGPLKLLKDQARIIARVGSITFVGSTAQVFFSRQLI
PLNVAAKRPDPTWWIATVAFTRVDVPEKQDQQDIDPDGFRCTSYEVTRDYTRAPADASPDPAPAASKMPG
SGP
 
Nucleotide Sequence: 852 bp     [Download]
>gi|186474323|ref|NC_010627.1|:c303914-303063 Burkholderia phymatum STM815 plasmid pBPHY02, complete sequence
ATGGTATCGGTAATCAGACAGTGGCTCGCGGCTGGCGTGGGCTCGCGCAAGCGCGCCCCGACGCCGCCCA
TATCGGCCGCGCACCTGGAGGCAGCAGCGCGTGCGGTCGACCGGTCACAGCGTGACGCGGTCAGCTGGTA
TCTCGACCAGGCCCGGGAATTCGAGAGGTCGAAGATGGAGATGGCGGAAGAAAAGGCGCGCGTGGCCGAC
CGGCGATCAGTGCTTTCGGGTGGCATCGCCCTCGCGGCTGTTTTTGGCATAACAGCTTTAGGACTACTTA
AAAGACCCAATCCACCGGCGGTGTTGCGGGTGAACGACACGACCGGCAAGGTGGATGTGCTGCCAACGAC
CGCGAACGGCCACGTGAGCTTCACTGAAAAAACCGACCGCGCGGACCTGCGCCGCTATGTCGAGATGCGC
GAGAGCTACGACTGGGAGACGATTTCGGACATGCACAGCGCGGTGATGTTCATGAGCGACGATCGTGAAA
AGGACGCTTATGACGCGCTCATCCGTGGACCGGCCGGCCCGCTCAAGCTGCTCAAAGACCAGGCGCGCAT
CATCGCCCGGGTCGGCTCGATCACCTTTGTCGGTTCGACGGCGCAGGTGTTCTTCTCTCGGCAGCTGATC
CCGTTGAATGTGGCGGCGAAGCGCCCGGACCCGACCTGGTGGATTGCGACGGTGGCCTTCACGCGCGTCG
ATGTGCCAGAGAAACAGGATCAGCAGGACATCGATCCGGACGGGTTTCGGTGTACCAGTTACGAGGTCAC
ACGCGATTACACCCGCGCGCCAGCGGATGCATCGCCCGATCCCGCACCGGCCGCATCGAAGATGCCCGGG
AGCGGGCCATGA
 Primer design