SecReT4
Protein ID: 187729598
T4SS name [ID]Trw [143]
Gene symboltrwE
Locus tagR7K_015
StrainProvidencia rettgeri plasmid R7K (NC_010643)
Repliconplasmid R7K [GenBank: NC_010643] [Browse all T4SS(s) in this replicon]
Location [Strand]15215..16402 [-]
Productconjugal transfer protein
Component typeTrwE
UniProt IDB2G2P2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.3e-63, Aligned region: 205..383
Protein Sequence: 395 a.a.     [Download]
>gi|187729598|ref|YP_001874879.1| conjugal transfer protein [Providencia rettgeri]
MFGRKKGDVIDAGAELERAEQERIEGEYGASELASERRPHTPGARTLLMVLLCVIAVVLVTLSYKAYKVR
GVVEDDDAQPQQVVRQVIPGYTPRPIRPEPENVPEPPQPTTSVPAIQPAPVTQPVRPQPTGPREKTPYEL
ARERMLRSGLTAGSGGGEDLPRPQGGDAPAGGLMGGGGGGGELAEKLQPMRLSGSSAGRLGNRDMLITQG
TQLDCVLETRLVTTQPGMTTCHLTRDVYSTSGRVVLLDRGSKVVGFYQGGLRQGQARIFVQWSRIETPSG
VVINLDSPGTGPLGEAGLGGWIDRHFWERFGGAIMISLIGDLGDWASRQGSRQGDNSIQFSNTANGVESA
AAEALRNSINIPPTLYKNQGERVNILVARDLDFSDVYSLESIPTK
 
Nucleotide Sequence: 1188 bp     [Download]
>gi|187729584|ref|NC_010643.1|:c16402-15215 Providencia rettgeri plasmid R7K, complete sequence
ATGTTCGGTCGCAAGAAAGGAGACGTAATCGACGCGGGCGCGGAACTGGAACGCGCCGAGCAGGAACGTA
TCGAGGGCGAATATGGCGCTTCCGAGCTGGCTTCGGAACGTCGCCCGCATACTCCCGGTGCTCGCACGCT
GCTTATGGTGCTGCTGTGCGTGATTGCCGTGGTGCTGGTGACGCTCTCATACAAGGCGTACAAAGTGCGC
GGGGTTGTCGAGGATGACGACGCGCAGCCGCAACAGGTCGTGCGCCAAGTCATTCCGGGTTATACGCCGC
GTCCAATCCGACCCGAGCCGGAAAACGTACCTGAACCGCCGCAACCGACTACATCGGTTCCAGCGATTCA
GCCCGCGCCGGTAACGCAGCCAGTGCGCCCGCAACCGACCGGCCCGCGTGAAAAAACGCCCTATGAGCTG
GCCCGCGAACGCATGTTGCGCTCTGGCCTGACGGCGGGCAGCGGTGGCGGTGAGGATCTTCCTCGGCCGC
AAGGCGGCGATGCGCCTGCCGGTGGCCTCATGGGTGGCGGCGGTGGCGGCGGTGAGCTGGCCGAAAAGCT
GCAACCAATGCGCCTTTCGGGTTCAAGTGCTGGCCGCCTCGGCAACCGTGACATGCTGATAACGCAGGGA
ACGCAGCTCGATTGCGTGCTTGAAACGCGCCTTGTGACGACGCAACCCGGCATGACTACCTGCCATCTGA
CGCGGGACGTTTACTCGACCAGTGGCCGCGTAGTGCTGCTTGATCGTGGCTCTAAAGTCGTCGGGTTCTA
TCAAGGCGGGCTGCGGCAAGGCCAAGCGCGAATCTTCGTGCAGTGGTCGCGGATTGAAACGCCCTCCGGT
GTCGTCATCAACCTAGATTCTCCCGGTACTGGCCCGCTTGGCGAAGCTGGTTTGGGTGGCTGGATTGATC
GGCATTTTTGGGAGCGTTTCGGCGGTGCCATCATGATTAGCTTGATTGGTGATTTGGGCGATTGGGCAAG
CCGTCAAGGCAGTCGCCAAGGCGATAACTCTATCCAGTTTTCCAACACTGCGAACGGGGTGGAATCGGCT
GCTGCGGAAGCTCTGCGCAACTCGATCAACATTCCGCCCACTCTGTATAAAAACCAAGGCGAGCGGGTGA
ATATCCTCGTCGCCCGTGATCTGGATTTCAGCGATGTCTACAGTCTCGAAAGCATCCCCACTAAGTAG
 Primer design