SecReT4
Protein ID: 187729599
T4SS name [ID]Trw [143]
Gene symboltrwF
Locus tagR7K_016
StrainProvidencia rettgeri plasmid R7K (NC_010643)
Repliconplasmid R7K [GenBank: NC_010643] [Browse all T4SS(s) in this replicon]
Location [Strand]16402..17202 [-]
Productconjugal transfer protein
Component typeTrwF
UniProt IDB2G2P3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.8e-64, Aligned region: 30..240
Protein Sequence: 266 a.a.     [Download]
>gi|187729599|ref|YP_001874880.1| conjugal transfer protein [Providencia rettgeri]
MKKLAIVALLASLHAVPALALDVPTSSRYDHRIRYVTYNPADVVQVDTVLGVATHIMLEEGEQYLTHAFG
DSEAYAFARKGRHIFIKPQAELANTNLIVVTDRRSYKFRLQMRNDRNGAMYELAFRYPDTQARQTREANA
RAAVEAAFEQRVGAYYNLKYMMSGDKDIAPVNAWDDGRFTYFKFSANADLPSIYFVDAEGNESLVPRTTV
GSSNNIIAVHKVNPKWMIRLGNRALAIFNEAYDPNGVPNDTGTASPAVRRVNKGGN
 
Nucleotide Sequence: 801 bp     [Download]
>gi|187729584|ref|NC_010643.1|:c17202-16402 Providencia rettgeri plasmid R7K, complete sequence
ATGAAGAAACTAGCTATCGTTGCATTGCTGGCCTCGCTTCATGCGGTGCCCGCTTTGGCCCTCGATGTGC
CGACCAGCTCGCGTTACGACCATCGGATTCGATACGTGACGTACAACCCGGCTGATGTGGTGCAGGTCGA
TACCGTTCTTGGTGTCGCAACACACATCATGCTTGAGGAAGGTGAGCAATATCTGACGCATGCCTTTGGC
GATTCCGAAGCCTATGCCTTTGCCCGGAAGGGGCGGCATATTTTTATCAAGCCGCAGGCCGAGCTAGCCA
ATACCAACCTCATCGTCGTGACTGACCGACGCAGCTACAAATTCCGTTTGCAAATGCGGAATGACCGCAA
TGGGGCCATGTATGAGCTGGCTTTCCGTTATCCCGATACGCAGGCCCGGCAAACTCGGGAAGCGAACGCA
CGGGCCGCTGTCGAGGCTGCATTCGAGCAACGTGTAGGGGCCTATTACAACCTCAAATACATGATGAGCG
GCGACAAGGACATTGCGCCGGTCAACGCTTGGGATGATGGGCGTTTCACCTACTTCAAGTTCTCTGCCAA
TGCCGATTTGCCGTCGATCTACTTTGTGGATGCGGAAGGCAATGAAAGCCTTGTGCCGCGCACTACGGTT
GGCTCGTCCAACAACATCATTGCCGTTCACAAGGTCAATCCCAAGTGGATGATTCGACTTGGTAACCGCG
CCTTGGCGATCTTCAATGAAGCGTATGACCCCAATGGTGTGCCGAATGACACTGGCACAGCCTCCCCGGC
GGTTCGTCGCGTCAACAAAGGAGGCAACTAA
 Primer design