SecReT4
Protein ID: 187729600
T4SS name [ID]Trw [143]
Gene symboltrwG
Locus tagR7K_017
StrainProvidencia rettgeri plasmid R7K (NC_010643)
Repliconplasmid R7K [GenBank: NC_010643] [Browse all T4SS(s) in this replicon]
Location [Strand]17214..17999 [-]
Productconjugal transfer protein
Component typeTrwG
UniProt IDB2G2P4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-58, Aligned region: 51..257
Protein Sequence: 261 a.a.     [Download]
>gi|187729600|ref|YP_001874881.1| conjugal transfer protein [Providencia rettgeri]
MHRLPSRSSRVISTGSRSTRRCPWKFSEGTMSKKQPKPVKAEQLKSYYEESRGLERDLIGEFVKSRKTAW
RVATASGLFGLLGMVCGIVGFSQPAPAPLVLRVDNATGAVDVVTTLREHESSYGEVVDTYWLNQYVLNRE
AYDYNTIQMNYDTTALLSAPAVQQDYYKLFDGSNARDRVLGNKARITVRVRSIQPNGRGQATVRFTTQQH
NSNGTVEAPQHQIATIGYTYIGAPMRSSDRLLNPLGFQVTSYRADPEILNN
 
Nucleotide Sequence: 786 bp     [Download]
>gi|187729584|ref|NC_010643.1|:c17999-17214 Providencia rettgeri plasmid R7K, complete sequence
GTGCATCGGCTCCCAAGCCGAAGCAGCCGAGTGATTTCAACCGGGAGCCGGTCAACAAGACGGTGCCCGT
GGAAATTCAGCGAGGGCACTATGAGCAAGAAGCAACCAAAACCGGTCAAGGCAGAACAGCTCAAAAGCTA
CTATGAGGAAAGCCGTGGCTTGGAACGGGATTTGATTGGCGAGTTCGTCAAATCGCGCAAGACCGCTTGG
CGGGTGGCAACGGCGAGCGGCCTTTTCGGCCTGCTTGGCATGGTGTGTGGAATTGTCGGGTTCTCCCAAC
CGGCTCCCGCGCCCTTGGTGCTTCGGGTGGATAACGCCACGGGTGCCGTCGATGTGGTGACGACGCTGCG
CGAGCATGAGTCCAGCTATGGCGAAGTGGTCGATACGTACTGGCTCAATCAGTACGTGCTCAATCGCGAA
GCCTACGACTACAACACAATCCAAATGAACTATGACACGACGGCGCTATTGAGCGCCCCGGCGGTTCAGC
AGGATTACTACAAGCTCTTTGACGGCTCGAATGCGCGTGATCGGGTCTTGGGGAACAAAGCCCGCATTAC
CGTTCGGGTGCGCTCCATCCAACCTAATGGCCGCGGCCAAGCGACGGTGCGCTTTACGACGCAACAGCAC
AACAGCAATGGCACGGTCGAAGCTCCGCAACATCAGATAGCGACGATTGGCTATACCTACATCGGTGCGC
CGATGCGTTCATCTGATCGGTTGCTTAACCCTCTTGGTTTCCAGGTCACAAGCTATCGCGCTGACCCGGA
AATACTCAATAACTGA
 Primer design