SecReT4
Protein ID: 187729601
T4SS name [ID]Trw [143]
Gene symboltrwH
Locus tagR7K_018
StrainProvidencia rettgeri plasmid R7K (NC_010643)
Repliconplasmid R7K [GenBank: NC_010643] [Browse all T4SS(s) in this replicon]
Location [Strand]17854..18048 [-]
Productconjugal transfer protein
Component typeTrwH
UniProt IDB2G2P5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 64 a.a.     [Download]
>gi|187729601|ref|YP_001874882.1| conjugal transfer protein [Providencia rettgeri]
MKTIIFAILMTGLLSACASAPKPKQPSDFNREPVNKTVPVEIQRGHYEQEATKTGQGRTAQKLL
 
Nucleotide Sequence: 195 bp     [Download]
>gi|187729584|ref|NC_010643.1|:c18048-17854 Providencia rettgeri plasmid R7K, complete sequence
GTGAAAACCATCATTTTTGCAATTTTGATGACGGGGCTATTGTCGGCGTGTGCATCGGCTCCCAAGCCGA
AGCAGCCGAGTGATTTCAACCGGGAGCCGGTCAACAAGACGGTGCCCGTGGAAATTCAGCGAGGGCACTA
TGAGCAAGAAGCAACCAAAACCGGTCAAGGCAGAACAGCTCAAAAGCTACTATGA
 Primer design