SecReT4
Protein ID: 187729604
T4SS name [ID]Trw [143]
Gene symboltrwJ
Locus tagR7K_021
StrainProvidencia rettgeri plasmid R7K (NC_010643)
Repliconplasmid R7K [GenBank: NC_010643] [Browse all T4SS(s) in this replicon]
Location [Strand]19430..20119 [-]
Productconjugal transfer protein
Component typeTrwJ
UniProt IDB2G2P8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 7.1e-59, Aligned region: 24..212
Protein Sequence: 229 a.a.     [Download]
>gi|187729604|ref|YP_001874885.1| conjugal transfer protein [Providencia rettgeri]
MKKLVMTAAVAAILGAASPVMAQGIPVFDGTRAADFLQQFARMKEQLDTAKDQLAEAQRMYEAVTGDRGL
GNLMRNAQLREFLPDDLRTVYDSANGGGYAGISGSINDILRDERLNGSVADMRRSIEERSRTAAATDKAV
GLRAYEGAQQRLAQIEGLMDEISRTQDQKAIEELQARIAGEQAAIQNETTKLQMIAQLRQAEQALISEQR
RERNMRILSSGNQGMPTIQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|187729584|ref|NC_010643.1|:c20119-19430 Providencia rettgeri plasmid R7K, complete sequence
ATGAAAAAGCTGGTTATGACGGCGGCGGTTGCCGCCATTCTCGGGGCGGCCAGCCCTGTAATGGCCCAGG
GCATTCCTGTTTTCGACGGCACGCGGGCGGCTGACTTCCTTCAACAGTTTGCCCGCATGAAAGAACAGCT
CGACACGGCCAAAGATCAGCTCGCGGAAGCGCAGCGTATGTATGAGGCTGTCACGGGCGACCGTGGCCTT
GGGAATTTGATGCGTAATGCGCAGCTCCGCGAGTTCCTGCCGGATGATTTGCGCACGGTCTATGACTCGG
CCAACGGTGGCGGCTATGCGGGCATTTCTGGCTCGATCAATGACATTCTGCGGGATGAGCGCCTTAACGG
CTCTGTGGCCGATATGCGGCGCTCTATCGAGGAACGCAGTCGCACGGCGGCGGCAACCGACAAGGCCGTT
GGCCTGCGGGCCTATGAAGGCGCACAGCAACGCCTCGCGCAGATTGAAGGGCTGATGGATGAAATTAGCC
GTACCCAAGACCAAAAGGCCATTGAAGAATTGCAAGCCCGTATCGCGGGCGAGCAAGCCGCTATCCAGAA
CGAAACGACGAAGCTGCAAATGATCGCGCAACTGCGGCAAGCAGAACAGGCGTTGATTTCGGAGCAACGA
CGCGAGCGCAACATGCGCATCCTGAGTAGTGGAAACCAAGGAATGCCGACTATCCAATGA
 Primer design