SecReT4
Protein ID: 187729607
T4SS name [ID]Trw [143]
Gene symbol-
Locus tagR7K_024
StrainProvidencia rettgeri plasmid R7K (NC_010643)
Repliconplasmid R7K [GenBank: NC_010643] [Browse all T4SS(s) in this replicon]
Location [Strand]22914..23252 [-]
Productconjugal transfer protein
Component typeTrwL
UniProt IDB2G2Q1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.5e-18, Aligned region: 17..110
Protein Sequence: 112 a.a.     [Download]
>gi|187729607|ref|YP_001874888.1| conjugal transfer protein [Providencia rettgeri]
MATSILTRKTNMKNLNYLRAKANGKLAAIFGAIAAMLTAQPAAAQGLEKARGVLETLQQELTTIVPIAAA
VILLCLGIAYAGRFIEKDTFVRWSIGVIIAGSAVQITAMLFT
 
Nucleotide Sequence: 339 bp     [Download]
>gi|187729584|ref|NC_010643.1|:c23252-22914 Providencia rettgeri plasmid R7K, complete sequence
ATGGCAACTTCAATCTTGACGAGGAAAACAAACATGAAGAACCTGAACTACCTCCGGGCGAAAGCTAACG
GAAAGCTGGCCGCGATTTTTGGAGCAATAGCGGCCATGCTCACCGCTCAACCGGCGGCGGCTCAAGGGTT
GGAAAAGGCGAGGGGCGTCCTCGAAACATTGCAGCAGGAACTTACGACGATTGTGCCCATTGCGGCCGCT
GTCATCCTGCTCTGCCTCGGCATCGCATACGCGGGCCGCTTCATCGAAAAGGATACGTTCGTGCGGTGGT
CTATCGGCGTCATCATCGCCGGTTCCGCCGTTCAGATTACGGCCATGCTGTTCACCTAA
 Primer design