SecReT4
Protein ID: 187729609
T4SS name [ID]Trw [143]
Gene symboltrwN
Locus tagR7K_026
StrainProvidencia rettgeri plasmid R7K (NC_010643)
Repliconplasmid R7K [GenBank: NC_010643] [Browse all T4SS(s) in this replicon]
Location [Strand]23603..24301 [-]
Productconjugal transfer protein
Component typeTrwN
UniProt IDB2G2Q3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 3.5e-22, Aligned region: 7..148
Protein Sequence: 232 a.a.     [Download]
>gi|187729609|ref|YP_001874890.1| conjugal transfer protein [Providencia rettgeri]
MALAEFAVIAAMCAPAIHPTTLSAVVTQESRGNIYAIGINGDHKLPRQPQTLEEAIATAEQLRRDGYNFD
AGLGQINIKNLEWLGMSIADLFDPCKNLKGAQTVLLDCYERAVPRYGDGQGALQAALSCYNTGNFQRGFS
NGYVQKVASHVGVTVPALEPVSGGTQEPAKLQAVPKGAARLAPAQTKPREGLADAFSHEASGVRDAFNAS
DAFSENEEEEKEVKATASVDQN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|187729584|ref|NC_010643.1|:c24301-23603 Providencia rettgeri plasmid R7K, complete sequence
ATGGCACTGGCAGAGTTCGCGGTGATCGCTGCCATGTGCGCGCCCGCTATCCATCCGACAACGCTTTCGG
CGGTTGTGACGCAAGAATCTCGGGGCAATATCTACGCCATCGGGATTAACGGCGATCACAAATTGCCGCG
TCAGCCGCAAACGCTTGAAGAAGCCATTGCGACCGCCGAACAGCTCCGCCGTGATGGGTACAACTTCGAT
GCGGGCCTCGGTCAGATCAACATCAAAAATCTGGAATGGCTCGGCATGTCTATCGCCGACCTGTTCGACC
CGTGCAAGAACCTGAAAGGGGCGCAAACCGTATTGCTCGACTGCTACGAAAGGGCAGTGCCGCGATACGG
CGACGGCCAGGGCGCATTGCAGGCGGCTTTGAGCTGCTACAACACGGGCAATTTCCAGCGCGGATTCTCC
AATGGCTATGTGCAGAAAGTGGCTTCTCATGTTGGCGTAACGGTGCCTGCGCTTGAGCCGGTATCTGGTG
GGACACAAGAACCGGCCAAGCTGCAAGCGGTGCCCAAGGGTGCGGCGCGTTTAGCTCCGGCACAAACGAA
GCCACGGGAAGGGCTTGCAGATGCCTTCTCTCATGAGGCGAGCGGTGTACGTGACGCATTTAATGCAAGC
GACGCCTTTTCGGAGAATGAAGAAGAAGAAAAGGAGGTGAAGGCAACTGCCTCCGTTGATCAAAATTGA
 Primer design