SecReT4
Protein ID: 187729876
T4SS name [ID]Tra_F [522]
Gene symboltraY
Locus tagpVT1_p05
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]4062..4241 [+]
ProductTraY
Component typeTraY_F
UniProt IDB2LS54
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 9.6e-20, Aligned region: 10..57
Protein Sequence: 59 a.a.     [Download]
>gi|187729876|ref|YP_001853770.1| TraY [Vibrio tapetis]
MTKNPNGTHVNVKLSEKHNRVLEQSKTHSKRTKRAEAQARLEHHLDLFGVNWEVPKNNR
 
Nucleotide Sequence: 180 bp     [Download]
>gi|187729868|ref|NC_010614.1|:4062-4241 Vibrio tapetis plasmid pVT1, complete sequence
ATGACCAAAAACCCCAATGGCACACACGTCAACGTCAAGCTCTCAGAAAAACACAATCGTGTTTTAGAGC
AGTCGAAGACCCACAGCAAACGAACCAAACGCGCTGAAGCCCAAGCCCGACTTGAGCATCACCTCGATTT
GTTTGGCGTGAATTGGGAAGTACCAAAAAACAACCGATGA
 Primer design