SecReT4
Protein ID: 187729877
T4SS name [ID]Tra_F [522]
Gene symboltraA
Locus tagpVT1_p06
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]4805..5092 [+]
Productputative conjugative transfer protein TraA
Component typeTraA_F
UniProt IDB2LS55
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 2.5e-06, Aligned region: 20..92
Protein Sequence: 95 a.a.     [Download]
>gi|187729877|ref|YP_001853771.1| putative conjugative transfer protein TraA [Vibrio tapetis]
MKCNSQRALAVGVAVGLGALLVTQPTLAADLFAGGKQAVKDTAGKGSLVETAMLGTGLLGAVVTGLMTRN
WFAALGGFAGGSILWNVGAPMVGLG
 
Nucleotide Sequence: 288 bp     [Download]
>gi|187729868|ref|NC_010614.1|:4805-5092 Vibrio tapetis plasmid pVT1, complete sequence
ATGAAATGTAACTCACAACGCGCTCTGGCTGTTGGCGTGGCCGTCGGGCTTGGCGCCCTCTTGGTCACTC
AACCCACGCTCGCCGCCGATTTGTTTGCCGGTGGCAAGCAAGCGGTCAAAGACACCGCCGGAAAAGGCTC
TCTAGTCGAAACCGCCATGCTCGGCACTGGCCTACTTGGCGCCGTGGTCACCGGACTCATGACGCGTAAC
TGGTTCGCCGCCCTCGGCGGATTTGCCGGAGGCTCCATCTTATGGAACGTCGGCGCCCCAATGGTCGGAC
TCGGCTAA
 Primer design