SecReT4
Protein ID: 187729878
T4SS name [ID]Tra_F [522]
Gene symboltraL
Locus tagpVT1_p07
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]5102..5404 [+]
Productputative conjugative transfer protein TraL
Component typeTraL_F
UniProt IDB2LS56
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1e-28, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|187729878|ref|YP_001853772.1| putative conjugative transfer protein TraL [Vibrio tapetis]
MEDPHQFFAVPKHMNKGRRLVGFPMDEVLPAFVTFGLAFWLGHEMIGMVIAMAWFGGLRYIKSQYGDHII
AQASYWWGASFMKRVLFTRTPAASKRYWIY
 
Nucleotide Sequence: 303 bp     [Download]
>gi|187729868|ref|NC_010614.1|:5102-5404 Vibrio tapetis plasmid pVT1, complete sequence
ATGGAAGATCCTCATCAGTTTTTTGCGGTCCCCAAACACATGAACAAAGGACGCCGCCTCGTCGGCTTCC
CCATGGATGAAGTGCTGCCAGCGTTTGTCACCTTTGGCCTCGCGTTTTGGCTTGGACACGAAATGATTGG
CATGGTGATAGCCATGGCGTGGTTCGGGGGATTGCGCTACATCAAATCCCAATACGGGGATCACATCATC
GCGCAAGCCAGCTATTGGTGGGGGGCTTCCTTTATGAAGCGCGTGTTATTCACGCGCACCCCCGCCGCCT
CCAAACGCTACTGGATATATTAA
 Primer design