SecReT4
Protein ID: 187729879
T4SS name [ID]Tra_F [522]
Gene symboltraE
Locus tagpVT1_p08
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]5414..5989 [+]
Productputative conjugative transfer protein TraE
Component typeTraE_F
UniProt IDB2LS57
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 3.6e-60, Aligned region: 1..184
Protein Sequence: 191 a.a.     [Download]
>gi|187729879|ref|YP_001853773.1| putative conjugative transfer protein TraE [Vibrio tapetis]
MDSFIKQDKLAIKSLLNLFLSLGFLAMLLTNLVLGFSVYQALTHKSRTLVPPVISKAFSLSDSQVDAPYL
EQMADYFLYLKLNVTPGNVGRQYGQLLEYVDEGSWATFQPNLLREAGAIKKGNISSQFAASTFTINLDEL
KVHVKGTLTKHVGTRTLPAESKWYQVNLTYHHGVLALQSIQTLEATDHASP
 
Nucleotide Sequence: 576 bp     [Download]
>gi|187729868|ref|NC_010614.1|:5414-5989 Vibrio tapetis plasmid pVT1, complete sequence
ATGGACAGTTTCATCAAACAAGACAAACTGGCGATAAAAAGCCTGCTCAATCTTTTTTTGAGCCTCGGCT
TTCTTGCCATGCTCCTCACCAATCTGGTGCTCGGTTTTTCGGTGTACCAAGCCCTCACCCATAAAAGCCG
CACCCTTGTGCCCCCGGTGATATCAAAAGCCTTCTCTTTGTCGGACTCCCAAGTGGATGCGCCCTACTTA
GAGCAAATGGCCGATTACTTTTTGTATCTCAAACTCAACGTCACCCCAGGCAACGTCGGTCGGCAATACG
GCCAACTGCTGGAATACGTAGACGAAGGCAGTTGGGCCACCTTTCAACCCAATCTGCTACGAGAAGCGGG
CGCCATCAAAAAGGGCAACATCAGCAGCCAGTTCGCTGCAAGCACGTTCACGATTAACCTTGATGAGTTG
AAAGTGCACGTAAAAGGAACGCTAACCAAACACGTAGGCACGCGCACGCTGCCCGCGGAGAGTAAATGGT
ATCAAGTCAACCTGACCTACCACCATGGCGTACTCGCCCTTCAATCCATCCAAACTCTAGAGGCCACCGA
CCATGCATCGCCCTAA
 Primer design