SecReT4
Protein ID: 187729880
T4SS name [ID]Tra_F [522]
Gene symboltraK
Locus tagpVT1_p09
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]6075..6767 [+]
Productputative conjugative transfer protein TraK
Component typeTraK_F
UniProt IDB2LS58
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 7.5e-58, Aligned region: 4..219
Protein Sequence: 230 a.a.     [Download]
>gi|187729880|ref|YP_001853774.1| putative conjugative transfer protein TraK [Vibrio tapetis]
MAQAQNAEKVTYPFSNGDTIPLSLSSINLNRLVVANDRILSIVCPQGFCTSSGNQKDASGSITLKINIAL
PFTAHLTTEKGRLFALFISPKATPGFVSEFTWAQSHLEQDSVMQTSADYPKGLTRLTKAMMRFVHDKAPI
EGFSQHPVDPATLPDDDAALAVIPTTVFVGRDYSGIIYTLRNQTQTLMTLTTAQFYSDSARSAALEAYEL
APGASTTLYLITGGGAAHVR
 
Nucleotide Sequence: 693 bp     [Download]
>gi|187729868|ref|NC_010614.1|:6075-6767 Vibrio tapetis plasmid pVT1, complete sequence
ATGGCGCAAGCCCAAAACGCAGAAAAAGTGACTTACCCCTTTAGTAATGGCGACACCATCCCTTTATCTC
TGTCTTCCATTAACCTCAACCGGCTCGTGGTGGCCAATGACCGAATTTTATCCATCGTGTGCCCGCAAGG
CTTTTGCACCTCATCGGGCAACCAAAAAGACGCCTCCGGCTCCATCACCTTAAAAATCAACATTGCTCTG
CCCTTTACCGCGCATTTGACCACCGAAAAAGGGCGCTTGTTCGCGCTGTTCATCAGCCCCAAAGCCACCC
CGGGCTTCGTGTCCGAATTTACGTGGGCGCAGTCTCATTTAGAGCAAGACAGTGTCATGCAAACCAGCGC
CGATTACCCCAAGGGCCTGACACGACTCACCAAGGCCATGATGCGCTTTGTCCATGACAAAGCGCCGATT
GAGGGATTTAGCCAGCACCCGGTAGATCCCGCCACGTTACCAGACGATGACGCAGCGCTGGCCGTCATCC
CCACCACCGTGTTTGTCGGCCGCGATTACTCGGGCATCATTTACACCCTGCGCAACCAAACCCAAACCCT
TATGACGCTCACCACCGCGCAATTTTACAGCGATTCCGCGCGCAGTGCGGCGCTTGAAGCTTACGAGCTG
GCTCCTGGAGCCAGCACCACCTTATACCTCATCACCGGGGGAGGCGCCGCGCATGTTCGATAA
 Primer design