SecReT4
Protein ID: 187729881
T4SS name [ID]Tra_F [522]
Gene symboltraB
Locus tagpVT1_p10
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]6757..8265 [+]
Productputative conjugative transfer protein TraB
Component typeTraB_F
UniProt IDB2LS59
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.8e-33, Aligned region: 245..443
Protein Sequence: 502 a.a.     [Download]
>gi|187729881|ref|YP_001853775.1| putative conjugative transfer protein TraB [Vibrio tapetis]
MFDNTKDRLSRVGRTFFKDRDGDFDQGERINQATHSRNLIITVVILAALALAGALVWQMTREATSVEPVT
QVGFGAVVGDDFTEKDNQSALTAQQLKINQLEQSLIKFESTLGRFGDSLTAELKNIEQASARNQSSTLSE
LERKMQDKLAEIDALKTQLTTQWQEAKKPAGQGASADVYSGRNFGEYALPPRPSVRDGQNNSNMADFQYQ
GKDNVAFAAQGFDSFEFTWAASEQERAPRRTVDNYVPTSTFVTAVVTGGADANAGVLGQGDTAPLVFQTL
NAGILPNGKPSKLRDCTVTASVYGEISSSRGIVRTHRLSCIQPSGDILDVPVKATAFNFGRNGIRGTTIL
KNGQIVKMAGISGILEGLGGAGKALSQTTTPTALGPSSSVSTDKIGLNLLGSATQSVGSKLADYYIQLAE
LYHPIVEVNPGAIVNLVFLEGFPLDPVLAQAYETELEEKAHAASNTNHIMDVITNAPTSAINPLADKLTQ
QGLNQTGFGRQE
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|187729868|ref|NC_010614.1|:6757-8265 Vibrio tapetis plasmid pVT1, complete sequence
ATGTTCGATAACACCAAAGACCGATTAAGCCGCGTGGGACGCACCTTCTTTAAAGACCGTGACGGGGACT
TTGACCAAGGCGAGCGCATCAACCAAGCCACGCACTCCCGCAACCTCATCATCACTGTGGTTATCTTGGC
GGCGCTCGCCTTAGCGGGCGCGCTGGTCTGGCAAATGACGCGAGAGGCCACCTCGGTTGAGCCCGTCACC
CAAGTGGGCTTTGGCGCCGTGGTCGGTGACGACTTCACCGAAAAAGACAACCAATCCGCCCTCACCGCGC
AGCAGCTTAAAATCAACCAGCTAGAGCAATCCCTGATTAAGTTTGAAAGTACGCTGGGGCGCTTTGGCGA
CAGTCTCACCGCAGAGCTTAAAAACATCGAGCAGGCGAGCGCGCGCAATCAAAGCTCGACCTTGAGTGAG
CTTGAGCGAAAAATGCAAGACAAACTGGCGGAAATCGACGCCCTCAAAACGCAACTCACCACGCAGTGGC
AAGAGGCGAAGAAACCGGCAGGCCAAGGCGCGTCAGCCGACGTCTATTCTGGCCGAAATTTTGGGGAGTA
TGCCCTGCCCCCTCGCCCGTCGGTTCGTGATGGGCAAAACAACTCGAACATGGCGGACTTTCAATACCAA
GGCAAAGACAACGTCGCGTTTGCCGCGCAAGGCTTTGACAGTTTCGAGTTCACCTGGGCGGCCAGTGAGC
AAGAACGCGCCCCTCGGCGCACCGTTGATAACTACGTGCCAACCAGCACCTTTGTGACCGCGGTGGTCAC
CGGGGGCGCGGATGCGAACGCCGGTGTCTTAGGCCAAGGCGATACGGCGCCGCTGGTTTTCCAAACCCTG
AACGCCGGCATTTTGCCAAACGGTAAACCGTCAAAGCTACGCGACTGCACCGTCACCGCCTCCGTTTATG
GGGAAATCTCATCCAGTCGCGGCATTGTTCGCACCCACCGTTTGAGCTGCATCCAGCCCAGCGGAGACAT
CTTAGACGTGCCCGTCAAGGCCACCGCGTTTAACTTTGGTCGCAACGGCATTCGAGGCACGACGATATTG
AAAAACGGTCAAATCGTTAAAATGGCCGGGATATCAGGCATCCTTGAAGGATTAGGCGGCGCCGGGAAAG
CCCTCTCTCAGACCACCACGCCGACCGCGTTAGGGCCAAGCAGCAGCGTCAGCACCGACAAAATCGGCCT
GAACTTACTGGGCAGTGCCACCCAAAGCGTCGGCAGCAAACTGGCTGACTATTACATCCAATTGGCGGAG
TTGTATCACCCCATCGTGGAAGTCAACCCGGGCGCCATCGTGAACCTGGTGTTCTTGGAAGGCTTCCCGC
TTGACCCCGTCTTGGCCCAAGCCTACGAAACCGAACTGGAAGAAAAAGCGCACGCCGCTTCCAATACCAA
CCACATCATGGACGTCATCACCAATGCGCCGACGAGCGCCATCAACCCCCTCGCCGATAAGCTCACTCAA
CAAGGGCTGAACCAAACCGGCTTTGGACGACAGGAGTAA
 Primer design