SecReT4
Protein ID: 187729882
T4SS name [ID]Tra_F [522]
Gene symboltraV
Locus tagpVT1_p11
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]8269..8649 [+]
ProductTraV type IV conjugative transfer system lipoprotein
Component typeTraV_F
UniProt IDB2LS60
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 3.9e-17, Aligned region: 22..115
Protein Sequence: 126 a.a.     [Download]
>gi|187729882|ref|YP_001853776.1| TraV type IV conjugative transfer system lipoprotein [Vibrio tapetis]
MKRIIISLTLLTLSGCAAGLDGDYGCKKIGGTSSCTTMDDIRNNPYGHAGQEHGDAILTPTAPASFTLLP
RRDRHGQPTRSRERVKKVTIFPFKDQDNDYVDTMDVYFVLDDSQWSGRPAPAIWQD
 
Nucleotide Sequence: 381 bp     [Download]
>gi|187729868|ref|NC_010614.1|:8269-8649 Vibrio tapetis plasmid pVT1, complete sequence
ATGAAGCGCATCATAATCAGCCTCACTTTGCTGACCTTATCCGGCTGCGCCGCCGGATTGGATGGCGACT
ACGGCTGCAAAAAAATAGGCGGCACATCGAGCTGTACCACCATGGACGACATTAGAAACAACCCTTACGG
TCATGCCGGTCAAGAGCATGGCGACGCCATCTTGACCCCCACCGCGCCCGCCTCTTTTACGCTGCTGCCA
AGGCGAGACCGACATGGCCAGCCGACACGAAGCCGTGAGCGGGTCAAAAAGGTGACCATTTTTCCTTTTA
AAGACCAAGATAACGACTACGTTGACACCATGGATGTGTATTTCGTGCTCGATGACAGCCAATGGTCAGG
GCGCCCCGCGCCGGCCATTTGGCAAGATTAA
 Primer design