SecReT4
Protein ID: 187729884
T4SS name [ID]Tra_F [522]
Gene symboltraC-W
Locus tagpVT1_p12
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]9041..12286 [+]
Productputative conjugative transfer protein TraC
Component typeTraC_F
UniProt IDB2LS62
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.2e-45, Aligned region: 454..744
TraC_F_IV [PF11130], Evalue: 2.7e-43, Aligned region: 21..254
TrwB_AAD_bind [PF10412], Evalue: 6.2e-05, Aligned region: 451..516
Protein Sequence: 1081 a.a.     [Download]
>gi|187729884|ref|YP_001853778.1| putative conjugative transfer protein TraC [Vibrio tapetis]
MFSQSTSGLSRLFTEAKKAQNHLHHELPYREHDAIDRVFRNQHAQGFGFRLSILGGANDTLIQSLNKLVA
DLPQGDKWDYQLQLFGHNRVAHYLESNEALLSKRGGVCAKMARDDAIYANYAAQAGFFHRQKNSHFDLRD
YDAFMFVSTCEDEPQALLDARITLETGLMQLGFDLQPLTPEALLTHVGDVLNFDPNQDRPQLKSYHPLES
LHRQALAPDTEMMTHREYIDTRHTNDKGEETRGRIVNMGLSKLPGDYRLYALPECFSSLRNVSRSIKCPH
MLTLNFRHEPTGKQNASNDAKIKDLTKTVESKMALLAPTAKDELAERKAIQAGLLGKSFTIASMVLTVTL
FTNRKEGKQHTQAAREAFSNAGLDIAPLKMLQPQALLSILPFMMSEGLWEDCKRVGRTRTVKSSNLVNFF
PLVLDFRQLKGGMLLPTMRQQISFFNPFTCGSDNQNIALTGGSGAGKSFFVQEMAENVYAMGGKVWILDK
GASYKKLTLSLGGTYMTHNNIYLNPFTHLGKMADAQFEFVDDDGTAVDPMMEALDNITALFATIASPYAP
LSTFQQSVLGDAIVQAWEAKGVDTLVDDVRDALIDIAGEEQDRRIKDIAVQLKKYGTDGTYSDVFNKPSM
LDPKVEFTTLELDGFPPAVLRPVIFALMVSINQQMYLSGSRSTPKLCIIEEAWSLLSGANEQAREFINTG
YRTARKFGGAFCTVTQGIEDFFSSEEAKASYNNSDIHILLRQGAGFDNYLTDNPNVFSSFDQAIIKGFEK
SSEAGYSCARIKAGGHVTYHRFSPPPSNAPCSPRSLTSLSIVKTWCKQATLWSRPLSKRPCTFTAMKSTP
SSKPYSKRRNACLLAALWVSLLWAGATTHSQAKDFGRVAPAFPIGEIDMLDWIEHRLKQFEANGKMADLQ
DTFTQRVKASIQTPTPVQGLLTTTSPRTFYVDPSVTLTKDLLVPNTGQRIAKAGTRINPFDPTTWPAIEG
QSVLPNFELSKVLVFFDARDAKQRRFASQYTHTKPIKWVLTGGSPNAMAALTGQQYYFAQQGFLTKQLHI
THLPAIAYQEGTRWRIDEVDVSGLMPLEKTP
 
Nucleotide Sequence: 3246 bp     [Download]
>gi|187729868|ref|NC_010614.1|:9041-12286 Vibrio tapetis plasmid pVT1, complete sequence
ATGTTTTCTCAATCCACCTCCGGCTTATCCCGCCTCTTTACCGAGGCCAAAAAAGCGCAAAACCACCTAC
ACCATGAACTGCCGTATCGAGAGCATGACGCCATTGACCGCGTTTTTCGCAATCAACATGCTCAAGGATT
TGGCTTTCGCCTCAGCATTCTGGGCGGCGCCAATGACACCCTCATTCAATCGCTCAACAAATTGGTGGCC
GATTTACCGCAAGGCGACAAATGGGACTATCAATTGCAACTGTTTGGCCACAATCGAGTGGCGCATTATC
TGGAAAGCAACGAAGCCTTACTCAGTAAACGCGGCGGCGTGTGCGCGAAAATGGCAAGAGATGACGCGAT
TTACGCGAATTACGCTGCCCAAGCCGGCTTTTTTCATCGACAAAAAAACAGCCATTTCGATTTACGCGAT
TATGATGCGTTTATGTTTGTCTCAACCTGCGAAGACGAACCCCAAGCCCTGCTGGATGCGCGCATCACGT
TGGAGACCGGGTTAATGCAATTGGGGTTTGATTTGCAACCGCTGACCCCGGAGGCGCTGCTCACTCATGT
GGGCGATGTGCTTAATTTTGATCCCAATCAAGACCGGCCACAGCTCAAGTCTTATCACCCTTTGGAGTCA
CTGCACCGCCAAGCGCTCGCCCCTGACACGGAAATGATGACGCACCGTGAGTACATTGATACGCGCCACA
CCAACGACAAGGGCGAAGAAACTCGCGGACGCATTGTGAACATGGGCTTATCCAAACTGCCCGGAGACTA
TCGTCTGTATGCGCTGCCAGAGTGTTTTTCGTCGTTAAGAAACGTCTCCCGCTCCATCAAATGCCCCCAT
ATGCTGACGCTCAACTTTCGTCATGAGCCCACCGGGAAACAAAACGCCAGTAATGATGCCAAAATCAAAG
ATTTGACCAAAACGGTGGAGTCAAAAATGGCGCTATTAGCGCCCACCGCTAAAGACGAGCTGGCCGAGCG
CAAAGCCATTCAAGCGGGATTGCTGGGTAAATCCTTTACCATCGCCAGCATGGTCTTGACCGTCACGCTG
TTCACCAACCGCAAGGAAGGAAAACAGCACACCCAAGCGGCCAGAGAAGCGTTCAGTAACGCCGGTCTCG
ATATCGCCCCCCTCAAAATGCTCCAGCCTCAAGCCTTGCTCAGCATCCTGCCCTTCATGATGAGCGAAGG
GCTTTGGGAGGATTGCAAGCGAGTCGGCCGCACTCGCACCGTGAAAAGCTCCAACCTGGTGAATTTTTTT
CCGCTGGTGCTGGACTTTCGCCAGCTCAAAGGCGGCATGCTGCTTCCGACCATGCGACAGCAGATCTCAT
TTTTTAACCCCTTTACCTGTGGCAGTGATAACCAGAACATTGCCCTGACGGGCGGCTCAGGGGCGGGCAA
AAGCTTCTTTGTCCAAGAGATGGCCGAGAACGTGTACGCCATGGGGGGCAAAGTGTGGATCCTCGATAAA
GGCGCCAGCTACAAAAAGCTCACCTTGAGTTTGGGCGGCACTTACATGACCCACAACAACATTTACTTAA
ACCCGTTCACTCACTTAGGGAAAATGGCCGACGCCCAATTTGAGTTTGTGGACGACGACGGCACCGCGGT
GGATCCGATGATGGAAGCGCTGGACAACATCACGGCTTTATTCGCCACCATCGCCTCGCCTTATGCGCCC
CTGTCCACGTTCCAACAAAGCGTTTTGGGCGACGCCATTGTCCAAGCGTGGGAAGCCAAAGGCGTAGACA
CCTTGGTGGATGATGTCAGGGATGCCCTCATCGACATTGCCGGCGAAGAGCAAGACCGCCGCATCAAAGA
CATTGCGGTGCAACTGAAAAAGTATGGCACCGATGGCACGTATAGTGATGTGTTTAACAAGCCGTCCATG
CTCGATCCTAAAGTGGAATTCACCACCTTGGAGCTCGATGGCTTTCCGCCTGCGGTGTTAAGACCGGTGA
TTTTCGCGCTCATGGTGTCGATTAATCAGCAAATGTACTTATCCGGCTCTCGCTCTACCCCGAAGCTGTG
CATCATTGAAGAAGCGTGGAGCTTGTTGAGTGGCGCCAACGAGCAGGCGCGCGAGTTCATTAACACCGGC
TATCGCACCGCTCGAAAATTCGGTGGCGCGTTTTGCACCGTCACGCAAGGCATTGAGGATTTCTTTAGTA
GCGAAGAAGCCAAGGCAAGCTACAACAATTCCGACATTCATATCTTATTACGACAAGGAGCCGGCTTTGA
TAACTACCTCACCGACAACCCCAACGTGTTCTCCTCCTTTGACCAAGCCATCATCAAGGGGTTTGAGAAA
TCCAGCGAAGCGGGCTACAGCTGCGCGCGCATCAAAGCGGGTGGACACGTTACCTACCACCGCTTTTCGC
CTCCCCCGTCAAACGCGCCATGCTCTCCACGGAGCCTCACGAGTTTGAGTATTGTGAAAACTTGGTGCAA
GCAGGCCACGCTTTGGAGTCGGCCATTGAGCAAACGTCCATGCACTTTTACGGCGATGAAATCCACGCCT
TCCAGCAAGCCATACAGCAAGCGCCGTAACGCTTGCCTTTTGGCCGCGCTTTGGGTCAGTTTGTTGTGGG
CAGGGGCAACCACTCACAGTCAGGCCAAGGATTTTGGCCGGGTTGCCCCCGCCTTTCCCATTGGGGAAAT
CGACATGCTGGACTGGATAGAGCACCGATTAAAACAATTTGAGGCCAACGGGAAAATGGCCGACCTACAA
GACACGTTCACCCAACGGGTCAAAGCCAGCATCCAAACCCCCACGCCCGTCCAAGGGCTGTTAACCACCA
CCTCGCCGCGCACCTTTTATGTGGATCCCAGCGTGACGTTAACCAAAGACTTACTCGTTCCCAATACGGG
CCAGCGCATTGCCAAGGCGGGCACGCGCATCAACCCGTTCGATCCGACAACGTGGCCAGCCATTGAGGGT
CAATCGGTCTTACCCAATTTTGAACTCAGTAAAGTCTTGGTGTTCTTTGATGCCCGCGATGCCAAGCAGC
GGCGGTTTGCCAGTCAATACACCCACACCAAACCGATAAAATGGGTGCTCACTGGGGGCAGCCCTAACGC
CATGGCCGCCTTAACCGGTCAGCAATACTATTTTGCGCAACAAGGGTTTCTCACCAAGCAATTGCACATC
ACTCACCTTCCCGCGATAGCCTATCAAGAGGGCACGCGCTGGCGCATCGACGAAGTGGATGTCTCTGGCT
TGATGCCTTTGGAGAAGACGCCTTGA
 Primer design