SecReT4
Protein ID: 187729885
T4SS name [ID]Tra_F [522]
Gene symboltraU
Locus tagpVT1_p13
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]12412..13422 [+]
Productputative conjugative transfer protein TraU
Component typeTraU_F
UniProt IDB2LS63
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 7.1e-82, Aligned region: 31..335
Protein Sequence: 336 a.a.     [Download]
>gi|187729885|ref|YP_001853779.1| putative conjugative transfer protein TraU [Vibrio tapetis]
MHRLLLRSTLALLLVLSAPSTLAAGPACKSRFINPITDICWDCLFPMTIGAATVLPSKYPDTRNPSFPIS
FCPKPPPIFMQVGINIGYWEPYALTDITRVPYCMVNMGIEMGGANKQKIGGRITARESDSSDGGFYHAHW
YKYPLIYWLQLMQSAACMATDSFDVAYLTEIDPIWDDDELALVLNPEALLFGNVVAQLACVPEAMLTSTN
SSLPIDALFWCLGSQGSAYPLTGTTNYRDTPIQAATLLMERLNYKLHRQGMVWETRGESGAICYQYPDPL
LPKSRYRYQMSAPIADAQWCHPYTTTTTLWEAGHDNPVTGDNFGFVQWRKRNCVFL
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|187729868|ref|NC_010614.1|:12412-13422 Vibrio tapetis plasmid pVT1, complete sequence
ATGCACCGCTTACTGTTGCGCTCAACACTTGCCCTCCTACTCGTGTTAAGCGCCCCCTCTACGCTCGCCG
CCGGCCCCGCCTGCAAGAGTCGTTTTATCAACCCCATTACCGATATTTGCTGGGACTGCTTGTTTCCGAT
GACGATTGGCGCCGCCACCGTATTGCCTTCCAAATACCCCGACACCCGCAACCCGTCTTTTCCGATTTCC
TTTTGCCCCAAGCCGCCGCCGATATTCATGCAAGTGGGCATCAACATCGGTTATTGGGAGCCTTATGCGT
TAACGGACATCACGCGCGTCCCTTATTGCATGGTCAACATGGGCATTGAAATGGGGGGCGCCAATAAGCA
AAAAATAGGAGGACGCATCACCGCGCGCGAAAGCGACAGCAGCGATGGCGGTTTTTATCACGCCCATTGG
TACAAATACCCGCTCATTTACTGGTTACAACTGATGCAATCGGCCGCGTGCATGGCGACCGATAGTTTTG
ATGTGGCTTATCTCACTGAAATTGACCCCATTTGGGACGACGATGAGCTGGCCCTGGTGCTCAACCCTGA
AGCGTTATTGTTTGGTAATGTGGTGGCGCAGCTTGCGTGCGTGCCAGAGGCCATGCTCACCTCGACCAAT
TCATCCTTGCCCATTGATGCCCTGTTTTGGTGTTTGGGCTCCCAAGGCAGTGCCTATCCGTTAACGGGCA
CAACGAACTATCGAGACACGCCCATCCAAGCGGCCACCCTGCTGATGGAAAGGCTCAATTATAAATTGCA
TCGCCAGGGCATGGTGTGGGAAACGCGCGGCGAAAGCGGGGCGATTTGCTACCAATATCCAGATCCACTG
CTGCCCAAGTCTCGATACCGCTACCAAATGTCCGCGCCCATTGCAGACGCACAATGGTGTCACCCCTACA
CGACCACCACCACGCTGTGGGAGGCCGGTCATGATAACCCCGTCACCGGGGATAATTTTGGCTTTGTGCA
ATGGCGAAAACGCAATTGTGTCTTTTTATAA
 Primer design