SecReT4
Protein ID: 187729888
T4SS name [ID]Tra_F [522]
Gene symboltrbC
Locus tagpVT1_p14
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]13993..14700 [+]
Productputative conjugative transfer protein TrbC
Component typeTrbC_F
UniProt IDB2LS66
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.6e-32, Aligned region: 105..218
Protein Sequence: 235 a.a.     [Download]
>gi|187729888|ref|YP_001853782.1| putative conjugative transfer protein TrbC [Vibrio tapetis]
MRPRLLRKACCFALWACALTSPLTHAYTKEELQAFQDIERRLAERPDAAIMAQSKTFHDQARAHRSEAQQ
ASKAAGLKLNPQSLSPLLDTPSAQTNPEQAPKGVMVFVSLTMPDTALTQLLKQSERTGIPLVIRGVLPQG
FTATVTRIQTLINQGNRPAIRSGFSISPDWFRQFDIQQVPTFVSIKPGQCQPKQSCLPTDYDVVTGNISL
YQALETLAQGDTQQEVATLLRALEH
 
Nucleotide Sequence: 708 bp     [Download]
>gi|187729868|ref|NC_010614.1|:13993-14700 Vibrio tapetis plasmid pVT1, complete sequence
ATGCGCCCTCGACTCTTACGCAAAGCCTGTTGCTTTGCGCTGTGGGCCTGCGCGCTCACAAGCCCGCTCA
CCCACGCGTACACAAAAGAAGAACTCCAAGCCTTTCAGGACATCGAAAGGCGCCTAGCGGAGCGCCCCGA
CGCCGCCATCATGGCGCAATCCAAAACATTCCATGACCAAGCCCGCGCGCATCGAAGCGAGGCGCAACAA
GCCAGTAAGGCCGCGGGGCTCAAGCTTAACCCGCAATCGCTCTCCCCCTTACTGGATACCCCATCCGCTC
AGACCAATCCAGAGCAAGCGCCCAAAGGCGTGATGGTGTTTGTGTCATTAACCATGCCAGACACCGCCCT
CACTCAATTGCTCAAACAAAGCGAGCGCACGGGCATCCCCTTGGTGATACGCGGCGTCCTGCCGCAAGGC
TTTACCGCGACCGTAACGCGCATTCAAACCCTCATCAATCAAGGCAACCGCCCAGCCATTCGCAGCGGTT
TCTCCATCAGCCCAGATTGGTTTCGGCAATTTGATATCCAGCAAGTGCCCACGTTCGTGTCCATCAAACC
CGGACAATGCCAACCCAAACAATCTTGCCTGCCCACCGATTATGATGTGGTCACGGGCAATATTTCGTTG
TATCAAGCCTTAGAGACGCTAGCGCAAGGCGACACCCAACAGGAGGTGGCGACGCTGCTGCGCGCACTCG
AGCATTAA
 Primer design