SecReT4
Protein ID: 187729889
T4SS name [ID]Tra_F [522]
Gene symboltraN
Locus tagpVT1_p15
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]14714..16444 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDB2LS67
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 2.1e-73, Aligned region: 298..534
Protein Sequence: 576 a.a.     [Download]
>gi|187729889|ref|YP_001853783.1| conjugal transfer mating pair stabilization protein TraN [Vibrio tapetis]
MRTFLPRFITLLCLCSPMLTHANQAHTYNDSAQWAKHTANQTLTPSTLPLNAKDYCKDAACKSGVDNPKE
SQLDDSTINSQKAHAFATNDTAQDITHNFNQGRPDIKNDPAMRFALLGQENAFEVTHGISNAYVDCKSGA
QCVIDPVPRQCNQPTRKQVPCEKVPIASVTVSPVIFICPQGWTNQGRDCTRQITQCRYDARNSVSASGGN
CGRLGGEWMIWDGRRVQSGKWKGKEKSDRNYDCRGGRHSGWSTTWEICGLINETMPATLTCQTGFSLSGG
NCIKNTFSWSPQCTLIKACKPISETCIEGEETRIVNGIPTTLPCWKYQINHECNTTDTCKPLPNDCTTTE
KRCSLKQNGVCVEEEVQKSCPEKTCHTTALECGEQSFCLDGDCYQETPKLNGNFDKSVAALAGLAEAVKD
VGSPPKIFTGKPMQCEKKIAGFNDCCSDSGWGQGLGAKCSEQEKALGKAKGKGLTLYVGEFCAKKILGAC
FRHKRSYCVYDSKLAKIIQQQGAMSQLGKGLGSSERPTCAPLTPEELGQINFEHIDFADFYPEMKANTNL
PNFDEIKHRLQSATGG
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|187729868|ref|NC_010614.1|:14714-16444 Vibrio tapetis plasmid pVT1, complete sequence
ATGCGCACATTCTTGCCCCGCTTCATCACACTATTATGCCTTTGCTCTCCCATGCTCACTCACGCCAATC
AAGCGCACACCTATAACGACAGCGCCCAATGGGCGAAACACACGGCCAACCAAACGCTCACCCCAAGCAC
CCTGCCCTTAAACGCCAAAGACTATTGCAAGGACGCCGCCTGTAAAAGCGGCGTGGATAACCCCAAAGAG
TCCCAACTCGATGACAGCACTATCAATAGCCAAAAGGCGCACGCCTTTGCCACCAATGACACCGCGCAAG
ACATCACCCACAACTTTAACCAAGGTCGGCCTGACATTAAAAATGACCCCGCCATGAGATTTGCGCTGCT
TGGCCAAGAGAACGCCTTTGAGGTGACGCACGGCATCTCCAATGCCTATGTGGATTGCAAGAGCGGCGCT
CAATGCGTCATCGACCCTGTCCCAAGGCAATGCAATCAACCCACACGAAAACAGGTTCCTTGCGAGAAAG
TCCCCATTGCCTCTGTGACCGTGAGTCCCGTCATTTTCATTTGCCCTCAAGGTTGGACGAATCAAGGACG
AGACTGCACGAGGCAAATCACACAATGTCGTTATGACGCCCGCAACTCTGTCTCCGCTAGCGGAGGCAAC
TGCGGGCGACTTGGGGGCGAATGGATGATATGGGATGGGCGTCGCGTTCAGAGCGGAAAATGGAAAGGGA
AAGAAAAATCGGATCGAAACTATGATTGTCGAGGAGGCCGACACAGCGGCTGGTCAACCACTTGGGAGAT
TTGTGGGCTCATTAATGAAACCATGCCCGCCACGCTCACCTGCCAAACAGGCTTCTCTCTTTCAGGCGGT
AATTGCATCAAAAACACCTTCAGTTGGTCACCGCAATGCACGTTAATTAAAGCCTGCAAGCCCATCAGTG
AAACCTGCATTGAGGGAGAAGAAACCCGGATAGTCAATGGTATCCCTACCACGTTGCCTTGTTGGAAATA
CCAAATTAACCATGAATGCAACACGACAGATACTTGCAAGCCACTGCCCAACGACTGCACAACCACAGAG
AAACGATGCAGCTTGAAGCAAAATGGCGTTTGTGTCGAAGAGGAAGTGCAAAAAAGCTGCCCTGAAAAAA
CCTGCCATACCACGGCACTCGAATGCGGTGAGCAGTCTTTTTGCTTGGATGGGGATTGCTACCAAGAAAC
GCCGAAGCTTAATGGCAACTTCGATAAATCCGTGGCCGCGCTCGCAGGCCTTGCCGAAGCGGTCAAAGAC
GTGGGCTCACCGCCCAAAATCTTCACAGGAAAACCGATGCAATGTGAAAAGAAAATCGCCGGCTTTAATG
ATTGCTGCAGCGATTCAGGTTGGGGGCAAGGCTTAGGCGCGAAATGCAGTGAGCAAGAGAAAGCCTTGGG
CAAAGCCAAAGGAAAAGGCCTCACGCTGTATGTCGGCGAGTTTTGCGCCAAAAAAATCCTCGGCGCTTGC
TTTCGACACAAACGCAGTTACTGCGTTTACGACAGTAAGCTGGCCAAAATCATCCAACAACAAGGGGCCA
TGAGTCAGCTTGGCAAAGGGTTAGGCTCTTCAGAGCGCCCCACTTGCGCGCCATTAACCCCCGAAGAGCT
CGGTCAAATCAATTTTGAACACATTGACTTTGCGGATTTTTATCCAGAGATGAAAGCCAACACCAACCTA
CCCAACTTTGATGAAATCAAACACCGGCTTCAAAGTGCCACGGGCGGATAA
 Primer design