SecReT4
Protein ID: 187729890
T4SS name [ID]Tra_F [522]
Gene symboltraF
Locus tagpVT1_p16
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]16465..17277 [+]
Productputative conjugative transfer protein TraF
Component typeTraF_F
UniProt IDB2LS68
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.8e-66, Aligned region: 39..259
Protein Sequence: 270 a.a.     [Download]
>gi|187729890|ref|YP_001853784.1| putative conjugative transfer protein TraF [Vibrio tapetis]
MLPSVKPRSMMMKKILRAIITLTLLVHGQPALANDAPLGWRWYNEPKSMPDTPKPKPLPSNTQTTVSPPS
PLSATQQMDWFHSMHDEAKNDAFIHPKDKEKRAHFLALNRFITAQTDEIGMTFKAVLLDKPELSYTKDHP
TEQAARQPYLALETQKKTDAVKQMQQEGWGFFFVYEGRDALTQKLAPSIQAFADEHHFDLLGISTDQTFI
TNLKENRHNQGKVTVPFTPALILVHPETGEMKPLAYGWISQTDLLGRFYNVATDFKASDF
 
Nucleotide Sequence: 813 bp     [Download]
>gi|187729868|ref|NC_010614.1|:16465-17277 Vibrio tapetis plasmid pVT1, complete sequence
ATGCTCCCATCCGTTAAACCAAGGTCTATGATGATGAAAAAAATCCTGAGGGCAATCATTACCCTAACGC
TGCTTGTTCATGGCCAGCCCGCTCTCGCCAATGACGCCCCGTTAGGGTGGCGATGGTACAACGAGCCCAA
GTCCATGCCTGACACGCCCAAACCCAAGCCACTGCCAAGCAATACCCAAACCACGGTGTCACCGCCGAGC
CCCCTCTCAGCCACGCAGCAAATGGACTGGTTTCATTCTATGCACGATGAAGCCAAAAACGACGCGTTCA
TTCACCCAAAGGACAAAGAGAAACGGGCGCACTTCTTAGCCCTGAACCGTTTCATCACCGCTCAAACCGA
TGAGATTGGCATGACCTTTAAAGCGGTCCTACTTGACAAGCCTGAGCTGTCTTACACCAAAGACCACCCA
ACAGAGCAAGCGGCCAGACAGCCCTATCTTGCCCTTGAAACACAAAAAAAGACGGACGCCGTCAAGCAAA
TGCAACAGGAGGGATGGGGTTTCTTCTTTGTCTACGAAGGCCGCGATGCCCTTACCCAAAAATTAGCGCC
CTCCATTCAAGCCTTTGCCGACGAGCATCACTTCGATTTGCTGGGCATAAGCACCGACCAGACCTTCATC
ACCAACCTAAAAGAAAACCGGCACAACCAAGGAAAAGTGACCGTGCCCTTTACGCCGGCGTTGATTTTGG
TGCACCCGGAGACGGGGGAGATGAAGCCATTGGCCTATGGCTGGATAAGCCAAACCGACCTTCTTGGGCG
GTTTTACAACGTGGCCACCGACTTTAAAGCCTCCGACTTTTAA
 Primer design