SecReT4
Protein ID: 187729892
T4SS name [ID]Tra_F [522]
Gene symboltraH
Locus tagpVT1_p18
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]17777..19108 [+]
Productputative conjugative transfer protein TraH
Component typeTraH_F
UniProt IDB2LS70
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 4.3e-110, Aligned region: 39..392
Protein Sequence: 443 a.a.     [Download]
>gi|187729892|ref|YP_001853786.1| putative conjugative transfer protein TraH [Vibrio tapetis]
MMRSFTHRLCTFYVHKRLFSLLFLSLAAPVTWADTNNALARFFDDTSYQANVSNPTAYQGQAANYYSGGS
LFVRTKIVDAQLVSVTVPAISAGCSGIDMFMGGFSHIKSDQLVKLGKAIIHNAPPFVVNLALQTWAPQLK
QNLDQLQATLDKYLNQSVNSCQAAQAAIGGLAAFAAPATKKHVCATLGTQNNAFSDWVEAQHQCGAGGQA
AGQLASAKGDASLKDMTKTNHNVIWSAIMTNPFLAADTKLAEFMMSLSGTYVYDKNGKPHYYPSLLTDNN
LIQTLLEGGKGDIYQCKNTGKDACVTLTKTTALTISKNNGIERRIRAILEGLLRTINTDQALTSQQKGFL
EFTQTPVLKFFIDATATQQTPDLGHYARMMSVELLNQYLTNMLAIARQSLQNTNNDLKDIERITQDIDNA
KRFTDGLADKAIHALLNKNALIA
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|187729868|ref|NC_010614.1|:17777-19108 Vibrio tapetis plasmid pVT1, complete sequence
ATGATGCGCTCATTTACTCACCGCTTATGCACATTTTATGTGCATAAGCGCCTCTTTTCTTTATTATTCT
TAAGCTTAGCTGCCCCCGTTACTTGGGCCGACACCAATAACGCGTTGGCGCGCTTTTTTGATGACACCAG
TTATCAAGCCAACGTCAGCAACCCCACCGCGTATCAAGGCCAAGCGGCAAACTACTACAGTGGGGGCAGT
CTTTTCGTGCGCACGAAGATTGTCGATGCGCAATTGGTCAGCGTCACCGTGCCCGCCATCAGTGCCGGTT
GCTCAGGCATTGACATGTTCATGGGCGGGTTTTCTCACATCAAATCCGACCAATTGGTGAAGCTGGGCAA
AGCCATCATTCACAACGCCCCGCCTTTTGTCGTGAATTTGGCCCTGCAAACCTGGGCGCCGCAGCTCAAG
CAAAACCTTGACCAGTTGCAAGCGACCCTCGACAAATACCTCAACCAATCGGTGAACTCCTGCCAAGCCG
CGCAAGCGGCCATTGGGGGACTGGCGGCGTTTGCCGCGCCCGCCACAAAAAAACACGTCTGCGCCACCTT
AGGCACGCAAAACAACGCCTTTTCAGACTGGGTGGAAGCGCAGCACCAATGCGGCGCCGGAGGACAAGCG
GCGGGGCAACTGGCGAGCGCCAAAGGCGATGCCAGCTTAAAAGACATGACCAAAACCAATCACAACGTGA
TTTGGTCCGCCATCATGACCAACCCCTTCTTAGCCGCAGACACAAAACTGGCCGAATTCATGATGAGCCT
GTCGGGCACTTACGTGTACGACAAAAACGGCAAGCCCCACTACTACCCAAGCTTGCTCACGGACAACAAC
CTCATTCAAACGCTGCTAGAGGGCGGAAAAGGCGACATTTACCAATGCAAGAACACGGGCAAAGACGCTT
GCGTCACTCTGACCAAGACAACCGCCCTCACCATCAGTAAAAACAACGGCATTGAACGTCGCATTCGCGC
GATATTAGAAGGGCTGCTGCGCACCATTAACACCGACCAAGCCTTGACGAGCCAGCAAAAAGGCTTTTTG
GAGTTCACCCAAACCCCGGTGCTGAAATTTTTCATTGATGCGACCGCCACCCAACAAACCCCGGATTTAG
GTCACTACGCGCGCATGATGTCGGTCGAGCTGTTAAACCAATACTTAACCAACATGCTCGCCATTGCCCG
GCAATCGCTTCAAAACACCAACAATGACTTAAAAGACATCGAACGCATCACCCAAGACATCGACAACGCC
AAGCGCTTCACCGATGGGCTGGCGGACAAAGCCATTCACGCCTTACTGAACAAGAACGCGCTCATTGCCT
AA
 Primer design