SecReT4
Protein ID: 187729893
T4SS name [ID]Tra_F [522]
Gene symboltraG
Locus tagpVT1_p19
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]19186..22017 [+]
Productputative conjugative transfer protein TraG
Component typeTraG_F
UniProt IDB2LS71
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.7e-109, Aligned region: 5..460
Protein Sequence: 943 a.a.     [Download]
>gi|187729893|ref|YP_001853787.1| putative conjugative transfer protein TraG [Vibrio tapetis]
MRTLEYYTYTGSEVVAKALNALATFFTTATFGSFLQICLGLGLISSLFMFMLSRNPKDLIKWGAVFFLVP
LLLINMKARVLVIDKTEPGKFFTVDNVPYLVALPTYFFSTVMVGMAEGVEAIFTTSDDERYGRTGMMFGS
ELYQLSRQSSVQEVALKKIWNDYFDNCMIGDVQINNKYSWDTLFSSPDIFAMLDTVRQSPLRAVFLDEGA
GKMSFKTCAQVYPIVKKRFTDAAGDNLTALAHHLLGKNAAKYKPQIALSLKRSYDKYVNISASASNNIKQ
NMVMNEIRYNLDRLDPTQSALNYAYTQNKLQTTSMWASLGLMAREYLPMLHTLIFMLFACLGFFIAGAAV
IPGLTALVLKNYVSTFAYLSTWPTLFAIINALQLWGLESLSTDVSGRFGGLVLSNANAMDELHSRFAWMT
GILMISVPAIAGGLLKGGQAVMSSMNYQLAGMINSTNARASAAAASGNLDFGNMQMDNHSMNNTNANKFD
DNTLTNTGHTYTQKGDGSVSTQHADGRMTYDSSQTTSRGNISANTQAMVQETVQNARSSTQQSLDQTTTQ
LGQTLNAGMALNERWNDSVSKNLSYGEGGSTGVNSQVSEGVNNMQSAIDNVSQNTGWSKDQSQSYLQSVH
GGADAGFGLGGKSGAGGPSPFSFGVSGGVKFSDEERTAYSNMSAEQQQQLEQATQQYSEGATTVANAASQ
IDHKDTRSDVEQYAHDFALNMQNTQSLTTSAMNSQSQLEALSETQTRLDSGSSSFSANSIQGFQNYLEAT
APNQEDVKRLMTAFQPEDIAEAKEKWQNYTRTEAFASIAGFEGDNSAKIKRMESDYQAGATQEGEKPALS
RGQRGLMDKEGERVQSAFEATTEAVLSAKQTGALYNDEYFEGTKESVYNQQARAQQDIAPPESMIDIRIK
PQVEAELNPERTEYVSSDQAYPAAPAYTKNPTQ
 
Nucleotide Sequence: 2832 bp     [Download]
>gi|187729868|ref|NC_010614.1|:19186-22017 Vibrio tapetis plasmid pVT1, complete sequence
ATGAGAACCTTGGAATATTACACCTACACCGGCTCTGAGGTCGTGGCCAAGGCGCTGAACGCCTTAGCCA
CGTTTTTTACCACCGCCACTTTTGGCAGCTTCTTACAAATCTGCTTGGGGCTGGGGCTCATCAGTAGCTT
GTTCATGTTCATGCTCAGCCGTAACCCCAAAGATTTGATTAAATGGGGCGCGGTGTTTTTTCTGGTGCCG
TTATTGCTCATCAACATGAAAGCGCGGGTCCTGGTGATAGACAAAACCGAGCCGGGTAAGTTTTTCACCG
TGGATAACGTGCCTTATCTGGTTGCGCTGCCCACCTATTTCTTTTCTACCGTCATGGTGGGCATGGCGGA
AGGGGTCGAGGCGATTTTCACCACCTCCGATGATGAGCGTTATGGCCGCACGGGCATGATGTTTGGCTCT
GAGCTGTATCAGCTTTCCAGACAATCGAGCGTACAAGAAGTGGCGTTAAAGAAAATCTGGAACGACTACT
TTGATAACTGCATGATTGGCGATGTGCAAATCAACAACAAGTACAGTTGGGATACCCTCTTTTCCAGTCC
CGACATTTTTGCGATGTTAGACACCGTGAGGCAAAGCCCCCTACGGGCGGTCTTTTTAGACGAAGGCGCG
GGTAAGATGAGCTTTAAAACCTGCGCGCAAGTCTACCCCATCGTCAAAAAACGCTTCACCGACGCCGCCG
GTGACAACCTCACGGCGCTGGCGCACCACCTATTAGGGAAAAATGCCGCCAAATACAAACCTCAAATCGC
GCTGTCGCTTAAACGCAGCTACGATAAATACGTCAACATCTCCGCCTCAGCGTCCAACAACATCAAACAA
AACATGGTGATGAACGAAATTCGCTACAACCTTGACCGCCTTGATCCCACTCAAAGCGCGCTCAACTACG
CCTACACCCAAAACAAACTGCAAACCACGTCCATGTGGGCCTCGCTTGGCCTCATGGCCCGCGAGTACTT
GCCTATGCTGCACACCTTGATTTTCATGCTGTTTGCCTGCTTGGGTTTCTTTATTGCGGGCGCGGCGGTC
ATCCCCGGACTGACCGCGCTGGTCTTAAAGAATTACGTATCCACCTTCGCGTACTTATCCACGTGGCCGA
CCTTGTTTGCCATCATTAATGCGCTGCAATTGTGGGGATTGGAATCCTTGTCCACCGATGTGTCTGGGCG
CTTTGGGGGGCTGGTGCTCTCCAACGCGAACGCCATGGATGAGCTTCACAGCCGCTTTGCTTGGATGACG
GGCATTCTCATGATAAGCGTCCCGGCCATTGCGGGCGGCCTTCTCAAAGGAGGTCAAGCGGTCATGTCCA
GCATGAACTACCAACTGGCGGGCATGATCAACTCAACCAACGCCCGCGCAAGCGCCGCGGCGGCCAGTGG
CAATTTGGATTTTGGTAACATGCAGATGGACAACCACAGCATGAACAACACCAACGCCAACAAATTTGAT
GACAACACCTTAACCAACACCGGGCACACCTACACGCAAAAAGGCGATGGCTCCGTGAGTACCCAACACG
CCGATGGCCGCATGACCTATGACAGCAGCCAAACAACCAGCCGGGGCAACATCAGCGCCAACACCCAAGC
CATGGTGCAAGAAACGGTGCAAAACGCGCGCAGCAGTACGCAACAATCGCTAGACCAAACTACCACGCAG
CTCGGCCAAACTCTGAATGCGGGCATGGCGCTCAATGAGCGCTGGAATGACAGCGTCAGCAAAAACCTCT
CTTACGGTGAGGGCGGCTCGACCGGCGTGAACTCACAAGTGAGCGAGGGCGTAAACAACATGCAATCGGC
CATTGATAACGTCAGCCAAAACACCGGCTGGAGCAAAGACCAATCGCAGTCGTACTTACAAAGCGTTCAC
GGCGGCGCGGATGCGGGCTTTGGCCTGGGCGGAAAAAGCGGCGCTGGCGGCCCTTCCCCGTTCAGTTTCG
GCGTCAGTGGCGGGGTGAAATTCTCAGACGAAGAGCGGACCGCCTACTCAAACATGAGCGCAGAGCAGCA
ACAGCAACTTGAGCAAGCCACGCAGCAATACAGTGAAGGCGCCACCACGGTTGCTAACGCCGCCTCGCAA
ATCGACCATAAAGACACGCGCAGCGATGTGGAGCAATACGCGCACGACTTTGCCTTAAACATGCAAAACA
CCCAATCCTTAACAACCAGCGCCATGAACAGTCAATCGCAATTGGAGGCCTTATCAGAAACCCAAACGCG
CTTAGATTCTGGCTCGTCCAGCTTCTCCGCCAACTCCATCCAAGGATTCCAGAATTACTTAGAGGCCACT
GCACCAAACCAAGAAGACGTCAAACGCCTCATGACCGCCTTCCAGCCGGAAGACATCGCCGAGGCGAAAG
AAAAATGGCAAAACTACACCCGCACCGAAGCCTTTGCCTCAATCGCGGGCTTTGAGGGCGATAACAGCGC
CAAAATCAAACGCATGGAGAGTGACTACCAAGCGGGGGCAACCCAAGAAGGAGAGAAACCTGCATTAAGC
CGTGGCCAACGCGGGTTAATGGATAAAGAGGGGGAACGCGTGCAATCGGCATTTGAGGCCACCACTGAGG
CGGTGCTTAGCGCCAAACAAACCGGCGCCTTGTACAACGATGAGTATTTTGAGGGCACAAAAGAGAGCGT
TTATAACCAGCAAGCGCGGGCGCAACAAGACATCGCGCCGCCTGAGTCGATGATTGATATCCGCATCAAA
CCCCAAGTCGAGGCAGAGCTTAACCCCGAAAGGACAGAGTACGTCAGCTCAGACCAAGCGTATCCGGCGG
CGCCGGCTTACACCAAAAACCCAACACAATAA
 Primer design