SecReT4
Protein ID: 187729898
T4SS name [ID]Tra_F [522]
Gene symboltraD
Locus tagpVT1_p20
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]24563..26668 [+]
Productputative conjugative transfer protein TraD
Component typeTraD_F
UniProt IDB2LS76
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 4.5e-151, Aligned region: 184..578
TraD_N [PF12615], Evalue: 5.2e-24, Aligned region: 36..131
TraG-D_C [PF12696], Evalue: 7.5e-22, Aligned region: 437..559
T4SS-DNA_transf [PF02534], Evalue: 5.6e-15, Aligned region: 242..560
AAA_10 [PF12846], Evalue: 3.7e-14, Aligned region: 205..255
AAA_10 [PF12846], Evalue: 3.7e-14, Aligned region: 420..511
Protein Sequence: 701 a.a.     [Download]
>gi|187729898|ref|YP_001853792.1| putative conjugative transfer protein TraD [Vibrio tapetis]
MPRPTRAKGNHFTRGGQITFHSIRMFFQVNNTLVTAAIWSVIALTGLMTWFRAPDNAFWSIFYYWRNRLY
ASLGHDLNSEVTTLWSGKRYVGTLASQLNNTQLINLYDEVIQQIQINFLLTIGLIVVLWMLAMRFFRRQG
EKQSEDFHVRGYQYAEPKRLTQDLKSRAKKLKKQGVGNGRISDFKIDGLALFKHEFEVQHLLADGTTGAG
KSVLLRKLLTWIRKRGDKAIVYDKGCTFTSKFFDPSQDTLLNPFDERCANWDVWCDAKDAPDFENIANAL
IPQHGEGDPFWVDSARTIFSSAAYQMSQDDKPCSTARLLSLILTSELETLGNFLQGTESASLVSKDIKKT
AISIKSVLATYIKSLRFLDGLDDKDAKGKHKRKPFSITDWVQDDKQKGFLFLSSNAQQHASLRPLISTWL
AIASNAILGLKADDNRRIWVIMDEMPSLHKLPELDNIISEVRKFGGCYVIGLQSYAQLVKTYGKNTADVI
FDLLNTRFYFRAPSAQMAQISSKDLGEQEVDVSRENISYGANALRDGVSIGHQTVTRPVVSSSEIQAMDD
LQCYLRVPGSSFITQLDLHFDKRRDVTPAFIKRDYTLSPAMIRAYQEAVYCECVAPGLFLSEEDRDVLAK
RQSEQFDTPEEMTLETDQIKAATQSDAVKHLASEEAAKLNVESDYQERAQQELEESAISQDIEMETGEMI
E
 
Nucleotide Sequence: 2106 bp     [Download]
>gi|187729868|ref|NC_010614.1|:24563-26668 Vibrio tapetis plasmid pVT1, complete sequence
ATGCCTAGACCCACGCGCGCCAAAGGGAATCACTTTACCCGTGGCGGACAAATCACCTTTCACTCCATTC
GGATGTTCTTTCAAGTCAACAACACCTTAGTCACCGCCGCCATTTGGTCAGTGATTGCCTTAACCGGCTT
GATGACCTGGTTCAGAGCGCCGGATAACGCCTTTTGGTCCATCTTCTATTACTGGCGTAATCGGCTTTAT
GCCAGTTTAGGCCACGACCTCAACAGCGAAGTCACCACCCTATGGAGTGGGAAGCGCTACGTCGGCACGC
TTGCCTCTCAATTGAACAACACCCAACTCATTAACCTGTATGATGAGGTTATCCAGCAAATACAAATCAA
CTTCTTGCTCACCATCGGACTGATTGTTGTGCTCTGGATGCTGGCCATGCGCTTTTTCAGACGACAAGGG
GAAAAGCAAAGTGAAGACTTTCATGTTCGGGGCTATCAATACGCGGAGCCTAAACGACTGACCCAAGATT
TAAAATCGCGGGCCAAAAAGCTGAAAAAGCAAGGCGTCGGTAACGGGCGTATCTCGGATTTTAAGATCGA
TGGGCTTGCGTTGTTTAAACACGAATTTGAGGTGCAGCACCTACTCGCCGATGGTACTACGGGGGCCGGT
AAATCCGTGTTGCTGAGAAAGCTTTTAACCTGGATACGCAAGCGTGGGGATAAGGCCATTGTTTACGATA
AAGGCTGCACCTTCACCAGTAAGTTCTTTGACCCAAGCCAAGACACACTGCTTAACCCGTTTGATGAACG
TTGTGCCAACTGGGATGTGTGGTGTGACGCGAAGGATGCCCCTGATTTTGAGAACATCGCCAACGCGCTC
ATTCCCCAACACGGCGAAGGCGACCCGTTCTGGGTGGATTCCGCGCGCACCATCTTCTCCAGCGCCGCGT
ATCAAATGAGCCAAGACGACAAACCGTGCTCAACTGCCCGATTACTCAGCCTCATTTTAACCTCTGAGCT
TGAAACGCTGGGCAATTTCTTACAAGGAACCGAATCGGCCTCACTGGTCTCCAAGGACATCAAAAAGACC
GCCATCTCCATCAAGTCGGTGCTGGCCACCTACATAAAAAGTCTGCGTTTTTTAGATGGATTGGATGACA
AAGACGCCAAAGGCAAACACAAACGCAAACCGTTTTCTATTACCGACTGGGTACAAGATGACAAACAAAA
AGGCTTTTTGTTCTTATCCAGTAATGCGCAGCAACACGCCTCATTGCGCCCGCTCATCTCGACATGGCTT
GCTATCGCTTCTAATGCTATTTTGGGCTTGAAGGCCGATGACAACCGGCGTATTTGGGTCATCATGGATG
AGATGCCCAGTTTACATAAACTGCCAGAGCTGGATAACATCATCTCAGAGGTGCGTAAATTTGGGGGGTG
CTATGTGATTGGCCTCCAGTCTTACGCTCAATTGGTTAAGACTTACGGCAAAAACACCGCGGATGTGATT
TTTGATTTGCTCAACACCCGCTTCTATTTTCGCGCGCCGTCGGCACAAATGGCGCAGATTTCATCCAAAG
ATTTAGGGGAGCAAGAAGTGGACGTATCGAGAGAAAACATCTCTTATGGTGCAAACGCCTTGCGTGACGG
GGTCTCCATTGGCCATCAGACCGTGACTCGCCCGGTGGTGTCGAGCAGTGAAATACAAGCCATGGACGAT
TTACAATGTTACTTACGCGTCCCCGGTAGCAGTTTCATCACTCAACTGGATTTACACTTTGATAAGAGAC
GCGATGTGACGCCCGCGTTCATCAAGCGGGATTATACGCTCTCACCTGCCATGATACGAGCGTATCAAGA
AGCGGTGTATTGTGAATGTGTGGCGCCTGGACTGTTTCTTAGTGAAGAAGACCGGGATGTACTGGCGAAA
AGGCAATCGGAGCAGTTTGATACCCCCGAAGAGATGACGCTTGAGACCGACCAAATCAAAGCGGCCACTC
AAAGTGACGCAGTCAAACACCTCGCAAGCGAAGAAGCCGCTAAGCTCAACGTCGAGAGTGACTATCAAGA
GCGCGCGCAGCAAGAGCTTGAAGAGTCTGCGATATCTCAAGATATCGAGATGGAAACAGGAGAAATGATT
GAGTGA
 Primer design