SecReT4
Protein ID: 187729903
T4SS name [ID]Tra_F [522]
Gene symboltraI
Locus tagpVT1_p21
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]29174..34951 [+]
Productputative conjugative transfer protein TraI
Component typeTraI_F
UniProt IDB2LS81
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 1.8e-79, Aligned region: 7..313
AAA_30 [PF13604], Evalue: 3.8e-53, Aligned region: 471..570
AAA_30 [PF13604], Evalue: 3.8e-53, Aligned region: 1015..1209
Toprim_3 [PF13362], Evalue: 6.8e-10, Aligned region: 1760..1847
AAA_19 [PF13245], Evalue: 1.2e-06, Aligned region: 1029..1097
Protein Sequence: 1925 a.a.     [Download]
>gi|187729903|ref|YP_001853797.1| putative conjugative transfer protein TraI [Vibrio tapetis]
MLSISPLKSASGAAKYYLSEENPKDSPDLSLEKDAGDNYYLKEKDQEENTFWHGKLAIEAGLAGKAVDQP
TLESVLSGNLGDETIKGKRENHKSGFDLTFSAPKTISVLALVGGDARLIEAHNNAVKFALTELEKDVAQV
KVTHEKGIQEYENTDSMLFAVVRHKTSRENDPQVHSHALAANMTRDQEGDLRALSTSLKQKGGVINGTGE
RIYNFQKYYGILYQSQLAKDVQALGYSTRGVGNGQFEVSGVPQPIIEASSTRKQQIDQRTLDLGFDSRAA
KDVANLDTRKSKTYQSHESLNNQWQTKVRSQGYEPSELVGMAQQAKTSQDGITPDDTKAAIHRAIDHLGQ
YSTALHLEKIIELAASDFTKGGVQANAIELKTILDQQIKEGALIPLADKGQYTTQTLIDNEHSLMKSTQG
RAHHMRTHVDPSLLHRLDIPANQQQKLTDLFQSTKQFHVVNVHGSSQGIAQQLLNVGNHSGKRVQFVSQT
AKAKSEGVENIQRHSHTLGAWIAHHFSSEQRHTTQSLLQGATPFTNKDILLIDDANKMSAKELMSLTNQA
KQSNTKVVMLNRVSSRQGFKANNAIELYRKGNVERHTWVGGKSAPTDIKLHDNDTDRIARVYADLPDKAN
TQVIATSGVEQRRLTEAIRGQLKNTGALSRHETTLFTQTPHSLSKAQQPLVQHYKPGMTLTHWEKNKPQS
FVIASIDKESNTMTALSKRDGQSHRFDPSSRAFKKMKMQINKPQSLNIAQGERLRTLGKHFPSGLEGNQS
YLVTHINKESLMLESKGKTQRLSLESLKDAPLQYDYVHGANHIEQKAHTLLSGKTFTLSKPLINDLTEKT
ARLDVFTDKPNKAQSALEKEQVSPSAIERVLHTQNVNDRYLSGATQALLTQDVSQALSTLAKAQNAPLIE
KAVSFALNHLSEREAGFSQKALVVEAVRYAFEEAGGAITKDQIDTELAKRRDTLSAEYSDGTRWTTHAAL
ETEKRILQNITDGKGQHPPFAITKQVQAFLETQPRLTQGQQGSLTLISTTQDSFVAIQGLAGTGKSTMLE
SNIELIQLAKQVSQQPEQNVIGLAPTHAAVSELESKGVKAQTLESLLSDIRQGNRQASDYQGTLFFLDES
SMVSNKQADEFTTLVNASQSKAVLLGDKEQLLSLSAGKPFELAMRQGRLDTAYMTDIIRQQNDPLLNAAQ
NTIDKQPESALDKLQRQSPDAQGNHQHVISTLDENNQDRRQAQLEATEKLPYLVAKDYLERTPETRENTL
IIAYTNQERDDITAYVRVGLMKNEEIGKENIVATRLRSIGATGEELTTMMPYQKGLVLSTKPGEYATITH
VDSEHGVVTLEDASTGKTKPFLPRNRDHRFTTLFSVSEKPLSTGDKIVTRFTDKSRDIKANVEYRITQAS
PDSIMAQSKSGQTLTINPNELTDSHWDYAYSRTADMAQGATYPHVITAIKSKGALTNLRRAGIDVTRASQ
HVRLYTDNTTHLLKSWLSKESHKASAIETANQTPPQDTTYFNRNALPHEDVRFQNKSGDFDYNTFKEHIN
TQLPKYTESLAMHLLGKPNQSKSDRDYLTFGIGKSAIKVTLTGEHRGYFKDYTTGEKGSLINLIMSHKDM
GYKEAMTEANNLLNEPDKYQLEENSKHDKLLNTTPKHIAQFEERAKEYISQSKPIENTLAQTYLNKLGVN
HTHNDQVKFHPAVYSSEDKLFHPAMVTNIHNKQGETKAVEVTYLDHQGNKDDALDINPRTLGTKSKQLTT
FHQGEHVNTTLISTSIENSFLIREHTQGQMDIINVNHKNDIQNIPTDELRQNVIIVLNQGNHDVNPNNIE
KIVENFNGRDVQFMSDDHLKEDIKTCIDKLDRDNRAHDIELSEPHPTHQERELDTLNMDEKKERDSQSLE
HFETKAPSPQHEMDFNHPEKESDWENREIDRELER
 
Nucleotide Sequence: 5778 bp     [Download]
>gi|187729868|ref|NC_010614.1|:29174-34951 Vibrio tapetis plasmid pVT1, complete sequence
ATGCTTTCTATTAGCCCATTAAAATCCGCCTCTGGCGCCGCCAAATATTACCTTAGCGAAGAAAACCCAA
AAGACTCACCGGATCTCTCGTTAGAAAAAGACGCCGGTGACAATTACTACCTCAAAGAAAAAGACCAAGA
GGAGAACACCTTTTGGCATGGCAAGCTCGCCATCGAAGCGGGACTGGCAGGCAAAGCCGTAGACCAACCG
ACCTTAGAATCGGTACTCTCAGGCAACCTAGGCGATGAAACCATTAAAGGGAAACGGGAAAATCACAAAT
CAGGCTTCGATCTGACCTTTTCGGCTCCTAAAACCATCAGCGTTCTTGCGCTTGTTGGAGGAGATGCCCG
TCTCATTGAAGCGCATAACAACGCCGTCAAATTTGCTTTAACAGAGCTTGAAAAAGACGTGGCACAAGTC
AAAGTCACTCATGAAAAAGGGATCCAAGAATACGAAAATACGGATTCGATGCTATTTGCGGTCGTGCGCC
ATAAGACCAGCCGTGAAAATGACCCACAAGTCCACTCTCACGCTCTAGCGGCAAACATGACGCGAGACCA
AGAAGGTGATTTACGGGCTTTATCAACCAGCCTAAAACAAAAAGGCGGTGTCATTAACGGCACAGGCGAA
CGCATTTACAACTTCCAAAAATACTACGGTATCTTATACCAAAGCCAGCTTGCTAAAGACGTACAAGCCC
TTGGTTATTCCACGCGAGGCGTCGGTAACGGTCAGTTCGAAGTCAGCGGTGTCCCTCAACCCATTATTGA
AGCCTCATCGACTCGCAAACAGCAAATTGACCAACGCACCCTAGACTTAGGCTTTGATTCACGCGCGGCA
AAAGACGTCGCCAACCTCGATACACGTAAAAGCAAAACCTACCAGAGTCATGAAAGCCTCAATAATCAAT
GGCAAACTAAAGTACGCTCGCAAGGCTATGAGCCGTCTGAGTTAGTGGGAATGGCGCAGCAAGCCAAGAC
ATCACAAGATGGGATTACGCCAGATGATACGAAAGCTGCCATTCATAGAGCCATTGACCATTTGGGTCAA
TACAGCACCGCATTACACCTAGAAAAAATCATTGAACTTGCCGCGTCTGATTTTACCAAAGGAGGCGTTC
AAGCCAATGCGATTGAGCTTAAAACCATCCTAGACCAACAGATAAAAGAGGGCGCGCTTATTCCTTTAGC
CGATAAAGGGCAATACACCACCCAAACCCTGATTGATAATGAGCACTCACTCATGAAAAGCACCCAAGGA
CGGGCGCACCACATGCGCACCCACGTTGACCCCTCGCTCTTACATCGCCTTGATATTCCAGCCAACCAGC
AACAAAAGCTCACCGACCTATTTCAGTCCACCAAGCAGTTTCATGTCGTCAATGTGCATGGCTCATCACA
AGGCATCGCGCAGCAACTGCTTAATGTCGGCAACCACAGCGGCAAACGGGTTCAGTTCGTCTCCCAAACC
GCCAAAGCCAAATCAGAAGGCGTGGAAAATATTCAGCGCCACAGCCACACCTTAGGCGCCTGGATAGCCC
ATCATTTTTCATCGGAGCAGCGCCACACTACCCAAAGCTTGCTCCAGGGCGCAACGCCGTTCACCAACAA
AGACATCTTGCTCATCGACGACGCCAATAAGATGAGCGCTAAGGAGCTGATGAGTCTCACCAACCAAGCC
AAGCAATCCAACACCAAGGTGGTGATGCTGAACCGCGTCTCCAGTCGTCAAGGCTTTAAAGCCAACAACG
CCATTGAACTGTACCGCAAAGGCAACGTAGAGCGTCATACGTGGGTGGGTGGGAAAAGCGCCCCCACCGA
CATCAAACTGCATGACAACGACACCGATAGAATAGCAAGGGTCTACGCTGACTTACCGGACAAAGCCAAC
ACTCAAGTGATTGCCACCTCCGGCGTCGAGCAGCGGCGGTTAACCGAAGCGATACGAGGGCAGTTAAAAA
ACACCGGCGCCCTCTCTCGTCATGAAACCACCCTATTCACTCAAACCCCTCACTCTCTCTCCAAAGCGCA
GCAACCACTTGTCCAACACTACAAACCCGGCATGACCCTCACCCATTGGGAGAAAAACAAACCCCAAAGT
TTTGTCATTGCCAGTATCGACAAAGAGAGCAACACCATGACCGCACTCAGCAAACGCGATGGACAGTCAC
ACCGCTTTGACCCGTCCAGTCGCGCCTTTAAGAAGATGAAGATGCAAATCAATAAACCGCAAAGTCTCAA
CATCGCCCAAGGCGAACGCCTTCGCACGCTGGGTAAGCACTTTCCTTCTGGCTTAGAGGGCAACCAAAGT
TACCTTGTCACACACATTAACAAAGAAAGCCTCATGCTTGAGAGCAAAGGTAAAACGCAGCGCCTAAGTT
TAGAGAGTCTAAAAGACGCACCATTGCAATACGATTACGTTCACGGCGCCAACCATATTGAGCAAAAAGC
CCATACCTTGTTATCAGGAAAAACCTTTACTCTGTCTAAACCGCTGATAAACGACCTGACCGAAAAAACA
GCGCGCCTGGATGTCTTCACCGACAAGCCAAACAAAGCCCAAAGCGCCCTAGAAAAAGAGCAGGTCTCCC
CGTCAGCCATTGAGCGCGTCTTGCACACGCAAAACGTCAACGACCGCTACCTAAGCGGCGCCACCCAAGC
CTTGTTAACGCAAGACGTCAGTCAGGCGCTTTCGACCCTGGCAAAAGCGCAAAACGCCCCACTGATTGAA
AAAGCGGTCAGCTTTGCCTTAAACCATTTATCTGAGCGTGAAGCGGGGTTTAGCCAAAAAGCGTTAGTGG
TGGAGGCGGTACGTTACGCCTTTGAAGAAGCCGGCGGCGCTATTACCAAAGACCAGATTGACACGGAGCT
TGCCAAGCGCCGTGACACCCTTTCCGCGGAGTACAGTGACGGCACACGCTGGACAACACACGCGGCGCTG
GAGACTGAAAAACGCATCTTGCAAAACATCACTGATGGCAAGGGCCAACATCCGCCTTTTGCGATAACCA
AGCAGGTGCAAGCCTTTCTTGAGACCCAGCCTCGCCTCACTCAAGGACAACAAGGCAGCCTTACCCTGAT
TTCAACCACCCAAGACAGCTTTGTCGCCATTCAAGGCTTAGCCGGTACAGGGAAATCCACCATGCTTGAA
TCCAACATTGAACTTATCCAATTAGCGAAACAAGTCAGCCAACAACCCGAGCAAAACGTCATTGGCCTTG
CGCCCACCCACGCCGCCGTTTCTGAGCTGGAAAGCAAGGGCGTGAAAGCGCAAACCCTAGAGAGCCTACT
CAGTGACATCCGACAAGGCAACCGCCAAGCCAGCGACTATCAAGGCACTTTGTTCTTTCTCGATGAAAGC
TCCATGGTCAGTAACAAACAAGCCGATGAATTCACCACGCTGGTCAATGCCAGTCAATCCAAAGCCGTGT
TGTTAGGGGATAAAGAGCAGTTGTTATCTTTAAGCGCCGGTAAACCCTTTGAGCTGGCCATGCGTCAAGG
TCGCCTCGATACCGCTTACATGACCGACATCATTCGTCAGCAAAACGACCCCCTACTCAATGCCGCGCAA
AACACCATTGATAAGCAGCCCGAAAGCGCCTTGGACAAACTCCAACGCCAATCGCCTGACGCGCAAGGCA
ATCACCAACATGTCATCTCCACGCTGGATGAAAACAATCAAGACCGACGCCAAGCGCAGTTAGAAGCCAC
TGAAAAGCTGCCCTACCTGGTAGCAAAGGATTACCTAGAACGCACACCTGAAACCCGCGAAAACACGCTT
ATCATCGCCTACACCAACCAAGAGCGTGATGACATCACGGCCTACGTTCGTGTTGGCTTAATGAAAAACG
AGGAAATCGGCAAAGAGAACATTGTCGCCACGAGATTGCGCTCCATCGGCGCCACCGGTGAAGAGCTCAC
CACCATGATGCCGTATCAAAAAGGCTTAGTGCTGAGCACCAAGCCCGGTGAGTACGCCACCATTACCCAC
GTGGATTCGGAGCACGGTGTGGTGACGCTTGAAGACGCCAGCACAGGCAAGACAAAGCCGTTCTTACCGC
GTAACCGTGACCATCGTTTCACGACGCTTTTCTCTGTATCAGAAAAACCACTCTCAACAGGCGATAAGAT
TGTCACTCGCTTTACCGATAAAAGCCGCGACATCAAAGCCAATGTGGAGTACCGCATCACCCAAGCAAGC
CCGGATAGCATCATGGCGCAATCAAAAAGTGGCCAAACGCTCACCATCAACCCGAATGAGTTAACAGACA
GTCATTGGGATTACGCTTACAGCCGAACCGCGGACATGGCGCAAGGGGCCACGTACCCGCACGTCATTAC
GGCCATCAAAAGCAAAGGCGCATTAACCAACCTAAGACGTGCCGGCATTGATGTCACCCGCGCCAGCCAG
CACGTGAGGCTCTATACCGATAACACCACACACCTGCTCAAAAGCTGGTTATCCAAAGAAAGCCATAAAG
CTAGCGCGATAGAAACCGCCAACCAAACCCCACCCCAAGACACCACTTACTTTAACCGCAACGCCCTGCC
CCATGAGGACGTTCGCTTCCAAAATAAAAGCGGTGACTTTGACTACAACACCTTTAAGGAGCACATCAAT
ACACAACTCCCGAAATACACCGAAAGCCTAGCCATGCACTTATTAGGCAAGCCCAACCAGTCCAAATCCG
ACCGCGACTATTTAACCTTTGGCATTGGCAAATCCGCCATTAAAGTGACCTTAACAGGCGAGCATCGTGG
TTATTTTAAAGACTACACCACGGGCGAGAAAGGCTCGCTGATTAACCTCATCATGAGCCACAAAGACATG
GGCTATAAAGAGGCCATGACGGAAGCCAATAACCTGTTAAATGAGCCAGATAAATATCAACTGGAGGAAA
ACAGCAAACATGACAAATTACTCAACACCACGCCAAAGCATATTGCGCAATTTGAAGAAAGAGCCAAAGA
ATACATCAGTCAAAGTAAACCGATAGAGAACACACTGGCCCAAACTTACTTAAACAAGCTAGGGGTAAAT
CACACCCACAATGACCAAGTTAAATTCCACCCGGCAGTCTACTCGTCCGAAGACAAACTCTTCCATCCGG
CCATGGTTACCAATATTCACAACAAACAAGGCGAAACCAAAGCCGTTGAAGTGACCTACCTTGACCATCA
GGGAAATAAAGACGATGCCTTAGACATTAACCCAAGGACGCTGGGGACAAAATCCAAACAATTAACGACC
TTCCATCAAGGGGAGCATGTAAACACCACCCTCATCAGCACGTCGATTGAAAACTCGTTTTTAATACGCG
AGCACACTCAAGGCCAAATGGACATTATTAACGTCAACCACAAGAACGACATTCAAAATATACCCACGGA
TGAATTAAGACAGAATGTCATTATTGTCTTAAACCAAGGCAACCACGATGTAAACCCGAACAACATCGAG
AAGATTGTTGAGAATTTTAATGGTCGAGACGTTCAATTCATGTCAGACGATCATTTAAAGGAGGACATTA
AAACCTGCATAGATAAATTAGACCGCGATAACCGCGCGCATGATATCGAATTAAGCGAACCCCATCCCAC
TCATCAAGAAAGAGAATTAGACACACTGAACATGGATGAGAAAAAAGAACGGGACAGTCAATCCCTTGAA
CACTTTGAAACCAAAGCGCCGTCACCTCAACACGAGATGGATTTTAATCATCCAGAGAAAGAGAGCGATT
GGGAAAACAGAGAAATAGACAGAGAGTTAGAGAGATAA
 Primer design