SecReT4
Protein ID: 187729906
T4SS name [ID]Tra_F [522]
Gene symbolpilT
Locus tagpVT1_p23
StrainVibrio tapetis plasmid pVT1 (NC_010614)
Repliconplasmid pVT1 [GenBank: NC_010614] [Browse all T4SS(s) in this replicon]
Location [Strand]37349..37792 [-]
Productputative PilT protein
Component typeOrf169_F
UniProt IDB2LS84
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 147 a.a.     [Download]
>gi|187729906|ref|YP_001853800.1| putative PilT protein [Vibrio tapetis]
MNKLSVLMLWFPFPVFAFCFDEAGNHYNVSSDLLRAIATVESNLNPNAINENKNNVGEVVSSDYGLMQIN
SIWFDKLSDFNVNDQNVYDPCFNVSLGAWVLSANFASHGYNWNSVGAYNAGFSKRTETARKIYIQKVQSV
YYSQNVK
 
Nucleotide Sequence: 444 bp     [Download]
>gi|187729868|ref|NC_010614.1|:c37792-37349 Vibrio tapetis plasmid pVT1, complete sequence
ATGAATAAACTGTCCGTATTGATGCTATGGTTTCCTTTTCCCGTGTTCGCTTTTTGTTTTGATGAGGCTG
GCAATCATTATAATGTATCATCAGACTTACTCAGAGCCATTGCAACCGTTGAAAGTAACTTAAACCCTAA
TGCTATCAATGAAAATAAAAATAACGTCGGTGAGGTCGTGAGTAGCGATTATGGCCTAATGCAAATTAAC
TCAATCTGGTTCGACAAGCTTTCGGATTTTAATGTGAATGATCAGAATGTTTATGATCCGTGTTTTAACG
TGTCATTAGGTGCATGGGTATTAAGCGCGAACTTTGCCAGTCACGGTTATAACTGGAACAGCGTGGGGGC
ATATAACGCAGGGTTTTCCAAACGTACCGAAACCGCCAGAAAAATATACATCCAAAAAGTCCAATCTGTT
TATTATTCGCAAAACGTAAAATAA
 Primer design