SecReT4
Protein ID: 187729994
T4SS name [ID]VirB [421]
Gene symbolvirB
Locus tagSbBS512_0046
StrainShigella boydii CDC 3083-94
Repliconplasmid pBS512_33 [GenBank: NC_010657] [Browse all T4SS(s) in this replicon]
Location [Strand]27622..28650 [+]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB2TSI8
KEGG IDsbc:SbBS512_0046
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.1e-62, Aligned region: 20..322
Protein Sequence: 342 a.a.     [Download]
>gi|187729994|ref|YP_001878814.1| P-type DNA transfer ATPase VirB11 [Shigella boydii CDC 3083-94]
MNGVIPVSISNKSLDFYKNQVFQSFLDIEGLTEIAVNRPGEIWTEINGDWTFHNNDSVTFDFCKRFSQTL
ASFRGDEISDTKPLLSATLESGERVQVVFPPACERNTISITIRKPSTRQITHKEYVANGFYDYVQSGKKH
RTYDDELLDLFRARNIAAFMELAVAAGKTIVFAGATGSGKTTYMKSLIDFIPLNTRLITIEDAEEIKFFI
HKNYVHLFYPSESGSDSGSIITAAKLIKSCLRMKPDRILLAEIKGGDAWDFVKVAGSGHSGSMTSIHAAS
AKDAIIQMVTKCYQNRECQNLPFDVLRKIIMDSIDIVVHVGRDGVVRHMSDIYYKGAECENF
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|187729967|ref|NC_010657.1|:27622-28650 Shigella boydii CDC 3083-94 plasmid pBS512_33, complete sequence
ATGAATGGCGTTATTCCTGTCAGCATTAGCAATAAATCGCTCGATTTTTATAAAAATCAAGTATTCCAGT
CTTTTCTTGATATTGAAGGGCTAACAGAAATTGCTGTCAACCGTCCTGGTGAAATCTGGACGGAAATTAA
TGGTGACTGGACATTCCATAATAATGACAGTGTGACCTTTGATTTTTGTAAACGTTTTTCTCAGACGCTG
GCATCATTTCGGGGAGATGAAATCAGCGATACCAAGCCATTACTTTCAGCAACACTGGAATCAGGAGAAC
GTGTACAGGTCGTTTTTCCTCCTGCATGTGAGAGAAATACTATTTCAATCACCATACGTAAACCATCGAC
ACGGCAGATAACGCATAAAGAATATGTGGCGAACGGTTTTTATGATTATGTCCAGTCAGGAAAAAAACAC
AGGACATACGATGATGAGCTTCTTGATTTATTCAGAGCGAGAAATATCGCTGCTTTTATGGAGCTTGCCG
TAGCAGCAGGGAAAACCATTGTATTTGCCGGAGCAACGGGTTCCGGTAAAACAACATATATGAAGAGTCT
TATCGATTTCATACCATTGAATACACGGCTGATTACGATTGAAGATGCAGAGGAAATCAAATTTTTTATC
CATAAAAATTATGTGCATCTTTTTTACCCTTCGGAATCCGGCAGTGATTCCGGCTCTATCATAACAGCAG
CGAAATTAATCAAATCCTGTTTGAGGATGAAACCTGACAGAATTTTACTGGCGGAAATTAAAGGTGGCGA
TGCCTGGGATTTTGTGAAAGTTGCTGGTTCTGGTCACAGTGGAAGCATGACGTCCATTCACGCGGCCTCG
GCAAAAGATGCCATCATTCAGATGGTGACAAAATGTTATCAGAACAGAGAATGTCAGAATCTTCCTTTTG
ATGTTCTTCGTAAAATCATTATGGACAGTATTGATATTGTTGTTCATGTAGGCAGGGATGGTGTTGTCAG
GCATATGAGCGACATCTATTACAAAGGGGCTGAATGTGAAAACTTTTAA
 Primer design