SecReT4
Protein ID: 187729997
T4SS name [ID]VirB [421]
Gene symbol-
Locus tagSbBS512_0047
StrainShigella boydii CDC 3083-94
Repliconplasmid pBS512_33 [GenBank: NC_010657] [Browse all T4SS(s) in this replicon]
Location [Strand]28637..30499 [+]
ProductTraG/TraD family protein
Component typeVirD4
UniProt IDB2TSI9
KEGG IDsbc:SbBS512_0047
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.8e-92, Aligned region: 147..568
TraG-D_C [PF12696], Evalue: 1.5e-22, Aligned region: 422..541
TrwB_AAD_bind [PF10412], Evalue: 2.5e-14, Aligned region: 338..555
Protein Sequence: 620 a.a.     [Download]
>gi|187729997|ref|YP_001878815.1| TraG/TraD family protein [Shigella boydii CDC 3083-94]
MKTFNKSQSVFIFAVMLVAAWFAGSFIFFVLYFSQIKNLKPLKAVFRSIDAYRMDIFTDSLTLSVVTTDI
RVLAFVALGAGFVVSLIIPVAALIKLNEKKENIFGDARFATINDIRESNSFTLDGDEKDGIIVGIKDKKI
IRYVGAAFSAMGAGTRAGKGAGIVITNLMKYWWSVIILDPKRECFNITSLIRKVILGHEVYKFDPFSPVT
HRFNPLYYVSMGTSEGFNQLENLSLIIYPYKTDGADAGSYLNKTAGGVFKSYAVALWFMIKNDKAGLKTL
DIEPVFSMSKINQLFERAEPEHLLSFMNDIRSELRGKDKTLADIGVAGLKAFIEMEDKTKAQLKSNFLNG
LSPFANPNVANATDGNDFDLRQVRKKRMTIYFCISGDNARLAEKITNIFFQLGIQVNLEKMPTDDPEIKH
DCLFLLDEFPSIGAVDYIKSKSGLIAGYKLKLLIVYQVGSQLEEIYSYAGSKTLLASAPCKIVYSASDVK
DARELSEAMGTRTVTIGSKSKSRSRGGTSRSESENLIERPLVTTNELLTLKFSEEILAMKGENPIRCEKA
FYYLHEYFFGDFVKVAPELANIFPRKKGKLVMPPQKVFENEIVAKGYLAVKDVPDLDKAA
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|187729967|ref|NC_010657.1|:28637-30499 Shigella boydii CDC 3083-94 plasmid pBS512_33, complete sequence
GTGAAAACTTTTAATAAGTCGCAATCTGTTTTTATATTCGCTGTTATGCTTGTTGCGGCATGGTTTGCAG
GTTCATTTATTTTCTTTGTGCTTTACTTCAGCCAGATAAAGAATCTGAAACCATTGAAGGCTGTGTTCAG
ATCCATTGATGCGTACAGGATGGATATTTTTACAGACAGCCTTACTTTATCTGTTGTGACTACGGATATC
AGAGTTTTAGCCTTTGTTGCACTTGGAGCAGGATTTGTCGTGTCTCTTATCATCCCTGTTGCGGCGTTGA
TAAAACTGAACGAGAAGAAAGAAAATATTTTCGGTGATGCGCGATTTGCAACAATTAATGATATTCGTGA
GTCTAACAGTTTCACGCTTGACGGTGACGAAAAAGACGGGATTATCGTTGGTATAAAAGACAAGAAAATA
ATACGCTATGTGGGAGCAGCATTCAGTGCTATGGGAGCCGGAACAAGGGCTGGTAAAGGTGCTGGTATAG
TCATCACTAATCTTATGAAGTACTGGTGGAGTGTTATTATTCTCGATCCAAAAAGGGAGTGTTTTAATAT
CACCAGTCTTATCAGGAAGGTGATTTTAGGTCATGAGGTTTATAAATTTGATCCCTTTAGTCCGGTAACG
CACCGCTTTAACCCTTTGTATTATGTCAGCATGGGAACGAGTGAAGGTTTTAACCAGCTTGAAAATCTTT
CGTTGATTATTTACCCCTATAAGACAGATGGTGCGGATGCTGGTAGCTATCTTAATAAGACGGCGGGTGG
TGTTTTTAAATCTTATGCTGTCGCTTTATGGTTTATGATTAAGAATGATAAGGCTGGACTAAAAACGCTT
GATATTGAGCCTGTCTTCTCAATGTCTAAAATTAATCAGCTTTTTGAGCGTGCAGAACCCGAACATCTTC
TTTCATTCATGAATGATATTCGTTCAGAATTAAGGGGGAAAGACAAAACGCTTGCTGATATTGGTGTCGC
TGGCCTTAAGGCATTCATTGAGATGGAGGATAAAACAAAAGCACAACTCAAAAGCAACTTTCTTAATGGA
TTATCACCGTTTGCTAACCCCAATGTGGCGAATGCTACTGATGGAAATGATTTTGATTTGCGGCAGGTGC
GGAAAAAACGGATGACAATTTATTTCTGTATTTCTGGTGATAATGCCAGGTTGGCTGAAAAAATAACAAA
TATTTTCTTTCAGCTTGGTATACAGGTGAATCTTGAAAAGATGCCAACGGATGATCCGGAAATAAAGCAT
GACTGCCTTTTTCTACTGGATGAATTCCCGTCAATTGGTGCTGTAGATTACATCAAGAGTAAATCTGGTC
TTATTGCTGGTTACAAGCTGAAATTGTTGATTGTTTACCAGGTCGGCTCTCAGCTTGAGGAAATCTACAG
TTATGCAGGCAGTAAAACATTACTGGCAAGTGCACCCTGCAAAATCGTTTATTCTGCTTCTGATGTTAAA
GATGCACGGGAGTTATCAGAGGCGATGGGAACACGAACAGTAACTATCGGTTCGAAAAGCAAAAGTCGTA
GTCGTGGAGGAACATCGAGATCTGAATCAGAAAACCTTATTGAGCGTCCACTGGTAACAACAAATGAACT
ACTGACACTGAAATTTAGTGAAGAAATCCTGGCAATGAAGGGAGAAAACCCGATTCGTTGTGAAAAGGCA
TTCTACTATCTCCATGAGTATTTCTTTGGTGATTTTGTGAAGGTTGCTCCGGAACTTGCAAATATTTTCC
CCAGGAAGAAAGGAAAGCTGGTTATGCCTCCACAGAAAGTATTTGAAAATGAAATCGTCGCAAAAGGGTA
TCTGGCAGTAAAAGATGTTCCTGATCTCGATAAAGCGGCATAA
 Primer design