SecReT4
Protein ID: 187730008
T4SS name [ID]VirB [421]
Gene symbol-
Locus tagSbBS512_0043
StrainShigella boydii CDC 3083-94
Repliconplasmid pBS512_33 [GenBank: NC_010657] [Browse all T4SS(s) in this replicon]
Location [Strand]24927..25613 [+]
ProductTriG protein
Component typeVirB8
UniProt IDB2TSI5
KEGG IDsbc:SbBS512_0043
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.8e-53, Aligned region: 12..224
Protein Sequence: 228 a.a.     [Download]
>gi|187730008|ref|YP_001878811.1| TriG protein [Shigella boydii CDC 3083-94]
MSEKIEKKIETAKSFERQLYAENERSKKNAWRVAVAASLLSLCLGAAICVLVPLKEKELAIVAVGEKTGR
TELITQVKQEKILQSEALGRYFVNTYITLREGYNYPSLQYDYETVQLYSSNTVKDDYLRLYNSDMAPDKI
YHNNGSYVAVEVISNIISDATAPDKLASVRFKKTTRNFTTGQVSVSYWTARVTYRFEPEKSVKSSSRELN
PLGFTVTSYQTDREARGE
 
Nucleotide Sequence: 687 bp     [Download]
>gi|187729967|ref|NC_010657.1|:24927-25613 Shigella boydii CDC 3083-94 plasmid pBS512_33, complete sequence
ATGAGTGAAAAAATCGAAAAGAAGATTGAGACAGCTAAATCCTTCGAAAGACAACTCTATGCAGAAAATG
AACGGTCTAAGAAAAATGCATGGCGTGTTGCAGTGGCAGCATCATTACTGTCCTTATGTCTTGGGGCTGC
AATTTGTGTTCTTGTGCCATTAAAAGAAAAAGAGCTTGCTATTGTGGCTGTTGGCGAAAAAACAGGCCGT
ACAGAACTGATTACTCAGGTTAAACAGGAAAAGATCCTGCAATCTGAAGCACTAGGGCGGTATTTTGTAA
ACACGTATATTACCTTACGTGAAGGTTATAATTATCCGTCTCTTCAGTATGATTATGAGACTGTACAGCT
ATATAGTTCGAATACAGTAAAGGACGATTATCTTCGTCTGTATAACAGCGATATGGCTCCTGATAAAATT
TATCATAATAATGGTTCTTACGTTGCGGTTGAGGTCATCTCCAATATTATTTCTGACGCAACCGCGCCAG
ATAAACTGGCCTCTGTGCGCTTTAAAAAAACGACGAGAAACTTCACGACCGGACAGGTTTCAGTTTCATA
CTGGACGGCTCGTGTGACATATCGTTTTGAACCAGAAAAGTCGGTTAAAAGTTCCAGTCGTGAGCTTAAT
CCTCTCGGTTTTACTGTAACCAGTTACCAGACAGATCGGGAAGCCAGGGGGGAATGA
 Primer design