SecReT4
Protein ID: 187736785
T4SS name [ID]Tra_F [95]
Gene symbolTraL
Locus tagIPF_323
StrainEscherichia coli 1520 plasmid pIP1206 (NC_010558)
Repliconplasmid pIP1206 [GenBank: NC_010558] [Browse all T4SS(s) in this replicon]
Location [Strand]40193..40504 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDQ7B3W7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.3e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|187736785|ref|YP_001816523.1| conjugal transfer pilus assembly protein TraL [Escherichia coli 1520]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|187736741|ref|NC_010558.1|:40193-40504 Escherichia coli 1520 plasmid pIP1206, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design