SecReT4
Protein ID: 187736799
T4SS name [ID]Tra_F [95]
Gene symbolTraF
Locus tagIPF_297
StrainEscherichia coli 1520 plasmid pIP1206 (NC_010558)
Repliconplasmid pIP1206 [GenBank: NC_010558] [Browse all T4SS(s) in this replicon]
Location [Strand]52720..53493 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB1VCA1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 9.7e-79, Aligned region: 33..247
Protein Sequence: 257 a.a.     [Download]
>gi|187736799|ref|YP_001816537.1| conjugal pilus assembly protein TraF [Escherichia coli 1520]
MKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQT
ATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSARKAMLAHPELDYNLQYSHYNGTVRNQLAADQ
AQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQR
LGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 774 bp     [Download]
>gi|187736741|ref|NC_010558.1|:52720-53493 Escherichia coli 1520 plasmid pIP1206, complete sequence
ATGAAAGAAAAAGTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTA
TTTTTCCGGCGTCAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGA
AAATAAACCTGTACCTGCAGCCCCCCGTCAGGAACCGGATATTATGCAGAAACTGGCCGCACTGCAGACG
GCAACAAAGCGGGCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGC
TGCAAAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAGAAAGGCCATGCTGGCACATCC
TGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCAGCAGACCAG
GCGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGG
ACCCCATCGACGGGCAGCTGGCGCAGGTCATTAATGGCTTCCGGGATACCTATGGTCTGAGTGTTATTCC
CGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGC
CTCGGCGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGTAGTGTTCGTCCGTTATCAT
ACGGTTTTATTTCGCAGGACGACCTGGCAAAACAGTTCCTGAATGTCTCTGAGGATTTTAAACCGAATTT
TTAA
 Primer design