SecReT4
Protein ID: 187736802
T4SS name [ID]Tra_F [95]
Gene symbolTraQ
Locus tagIPF_293
StrainEscherichia coli 1520 plasmid pIP1206 (NC_010558)
Repliconplasmid pIP1206 [GenBank: NC_010558] [Browse all T4SS(s) in this replicon]
Location [Strand]54245..54529 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDB1VCA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.2e-49, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|187736802|ref|YP_001816540.1| conjugal transfer pilin chaperone TraQ [Escherichia coli 1520]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVHSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMAEQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|187736741|ref|NC_010558.1|:54245-54529 Escherichia coli 1520 plasmid pIP1206, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGCG
TCTGGTTTCATATCGTCGCCCGTCTTGTTCACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGCAGAGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design