SecReT4
Protein ID: 187736812
T4SS name [ID]Tra_F [95]
Gene symbolTraX
Locus tagIPF_270a
StrainEscherichia coli 1520 plasmid pIP1206 (NC_010558)
Repliconplasmid pIP1206 [GenBank: NC_010558] [Browse all T4SS(s) in this replicon]
Location [Strand]68809..69612 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDB1VCB4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 7e-50, Aligned region: 51..266
Protein Sequence: 267 a.a.     [Download]
>gi|187736812|ref|YP_001816550.1| conjugal transfer pilus acetylation protein TraX [Escherichia coli 1520]
MTCRKRKPWAETDTGRQTLMTTDNTNTIRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINL
IFQLKQEWMFLVGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGHILFAFA
VVAQVLTWCETRSGWRTAAAILLMAQWGPLSGTSYGIAGLLMLAVSHRLYRAEDRAERLALVACLLAVIP
ALNLATSDAAAVAGLVMTVLTVGLVSCAGKSLPRFWPGDFFPTFYACHLAVLGVLAL
 
Nucleotide Sequence: 804 bp     [Download]
>gi|187736741|ref|NC_010558.1|:68809-69612 Escherichia coli 1520 plasmid pIP1206, complete sequence
GTGACCTGCAGAAAGAGAAAACCCTGGGCGGAGACTGATACAGGAAGACAAACACTGATGACAACGGATA
ACACGAACACGATACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGTCATTTCTGGTCTG
GTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTACTGGACCACATCAATCTG
ATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGTCGGGCGTGGGGCCTTTCCGCTTTTTGCCCTGGTGT
GGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGTGGGGATGGGGAAT
TATTGCCCAGTTCGCATATTATCTGGCAGGCTTTCCCTGGTATGAGGGGCATATCCTGTTTGCCTTTGCA
GTGGTGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCGGCCATTCTCCTGA
TGGCCCAGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGCTGGCAGTCAGCCA
CCGGCTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGGTCGCCTGCCTGCTGGCTGTTATTCCG
GCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCTGGTCTTGTGATGACGGTGCTGACCGTTGGTC
TGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGAGACTTTTTCCCGACGTTCTATGCCTG
TCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTGA
 Primer design