SecReT4
Protein ID: 187921140
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6495
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2785143..2786894 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDB2T8Y8
KEGG IDbpy:Bphyt_6495
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.9e-106, Aligned region: 15..448
TraG-D_C [PF12696], Evalue: 3.8e-28, Aligned region: 295..416
TrwB_AAD_bind [PF10412], Evalue: 1.7e-20, Aligned region: 205..430
Protein Sequence: 583 a.a.     [Download]
>gi|187921140|ref|YP_001890172.1| TRAG family protein [Burkholderia phytofirmans PsJN]
MNAPALIDAPAIVVGIWRGRYLRFTGQQFVLLAAPARSGKGVSIVIPNLLSYPDSVVVLDIKRENYAITA
GFRLAHGQEVYLFDPFAEDGRTHRFNPLSSISDGLFRVGDILAIGYALYPPNGHDDFWKDQARNLFLGIV
LLLSEWRDARRTGRGESIPDYPVTMGEVLRQSSGHGMPVKAYLQRALVQHRALLSGACVDALNRFLSNDD
KVLASILATFHAPLTIWANPIVDAATSANDFDLRDVRRRRMSVYIGITPDHLSEAALLVNLVFSQLVNLN
TKQLPEADPTLRFQCLLLLDEMTAIGKIHIIARAVAYMAGYNLRLLSVVQSIAQLESVYGRSDARTFLTN
HAMQILYAPREQKDANDYSEMLGTFTDQSRSVSRPNTMFGGRGGSSESMSEQRRPLLLPQELKELGRDKE
IIVLENTKPILADRICYWRDPVFASRVSIAPSVPAMDLARFTAQIERRLREVESDEVESDEIDPECAGLL
HLSAEYLEVLQAWDPRDLPPRLADLSEDEVAAYVERHFMLLGVPARHIGQATRRLSVADLDVAELVPPKS
ARERRGQGTRAGTNKASIKGARR
 
Nucleotide Sequence: 1752 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2786894-2785143 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAATGCGCCCGCACTGATTGATGCGCCGGCTATCGTCGTCGGGATATGGCGGGGGCGCTATCTGCGCT
TTACCGGGCAGCAGTTCGTGCTGCTCGCCGCGCCCGCGCGCTCGGGCAAGGGGGTCAGCATCGTGATCCC
GAACCTGTTGAGTTACCCGGATTCGGTTGTGGTCCTCGACATCAAGCGCGAGAACTACGCGATTACCGCG
GGCTTCCGGCTTGCACACGGGCAGGAGGTCTATCTCTTCGACCCGTTTGCGGAAGATGGCCGCACGCACC
GGTTCAATCCGCTGTCATCCATTTCGGATGGACTATTCCGCGTAGGCGACATTCTGGCGATCGGCTACGC
CCTCTATCCGCCAAATGGCCACGATGACTTCTGGAAGGACCAGGCACGTAACCTGTTTCTCGGCATCGTC
CTGCTGCTCAGTGAGTGGCGTGACGCGCGGCGCACGGGCAGGGGCGAATCCATCCCTGACTACCCCGTCA
CGATGGGCGAGGTGTTGCGGCAGTCGTCGGGCCACGGCATGCCGGTCAAGGCGTACCTGCAGCGCGCACT
CGTCCAGCATCGCGCTCTGCTGAGCGGCGCATGCGTCGATGCGCTGAACCGTTTCCTGTCCAACGACGAC
AAGGTGCTGGCGAGCATTCTTGCGACATTCCACGCACCGCTCACGATCTGGGCAAACCCCATCGTCGACG
CGGCGACGAGCGCTAACGATTTTGATCTGCGCGACGTGCGTCGGCGTCGCATGTCGGTCTATATCGGAAT
CACGCCCGATCACCTGTCGGAAGCGGCACTGCTCGTCAACCTCGTGTTCTCGCAGCTCGTCAACCTGAAC
ACAAAACAGTTGCCGGAGGCAGATCCAACCCTGCGGTTCCAGTGCCTGCTGTTGCTCGACGAGATGACGG
CAATCGGCAAGATCCATATCATCGCGCGCGCCGTGGCCTACATGGCGGGCTACAACCTGCGTCTGCTCTC
TGTCGTGCAGTCGATTGCGCAACTCGAGTCGGTCTACGGCCGGTCCGATGCACGTACCTTCCTCACGAAC
CACGCGATGCAGATCCTCTATGCGCCGCGTGAGCAGAAGGACGCGAACGACTACTCGGAGATGCTCGGCA
CCTTTACTGACCAGTCGCGCAGCGTCAGTCGCCCGAACACGATGTTCGGCGGCCGGGGCGGATCGAGCGA
GAGCATGTCCGAGCAACGTCGCCCGCTGCTGCTGCCGCAGGAACTCAAGGAACTGGGGCGTGACAAGGAA
ATCATCGTGCTGGAGAACACGAAGCCGATTCTCGCCGACCGGATCTGCTACTGGCGCGATCCGGTGTTTG
CTTCGCGGGTCTCGATTGCACCATCGGTGCCGGCCATGGATCTGGCCCGCTTCACGGCACAGATCGAACG
GCGTTTGCGCGAGGTCGAGTCCGACGAGGTCGAGTCCGACGAGATCGATCCGGAATGCGCGGGTCTCCTT
CATCTGTCGGCTGAGTATCTGGAGGTGCTGCAGGCCTGGGACCCGCGCGATCTGCCGCCGCGCCTTGCCG
ACCTCAGTGAGGACGAGGTCGCGGCATACGTTGAACGGCACTTCATGCTGCTGGGCGTTCCGGCCAGGCA
TATCGGACAGGCGACACGCCGACTGTCGGTCGCAGACCTCGACGTCGCGGAGCTGGTGCCGCCAAAGTCA
GCACGTGAGCGGCGCGGTCAGGGGACTCGTGCCGGAACGAACAAGGCATCGATTAAGGGAGCAAGGCGAT
GA
 Primer design