SecReT4
Protein ID: 187921142
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6497
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2787303..2788421 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB2T8Z0
KEGG IDbpy:Bphyt_6497
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.7e-62, Aligned region: 31..337
Protein Sequence: 372 a.a.     [Download]
>gi|187921142|ref|YP_001890174.1| P-type DNA transfer ATPase VirB11 [Burkholderia phytofirmans PsJN]
MIVRPDMQERSVDTVLARLPDDASVRELMRPFAPLLDDADVTELVINRPQRVLTETHLGWHGHDYDDLDY
ERLMSFAVAVATLTNQEVSAQHPVLSALLPGDARIQIVVPPVVPPRTVSVTIRRPSAREKSLDAYRDEGL
FDDTLWHRPDGLDAALPTLRPTDRRLVRCLEERYWCAFFEQAVTGRLNIVIVGNTGSGKTSFMKTLCRSI
PSTERIVTIEDVRELFIRHIENCVHLLYSKGGHGQARVTPADLIASTMRMRPDRVLLAELRGAEAYDFLK
LLTTGHVGSITSYHASSATVAIERFALMAKEHPEAAAYDDAALKRLLALTIDVVAHMEAYPLYDAAGEQI
GKRWGMTEIWFDPVRRARTTFS
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2788421-2787303 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGATTGTCCGCCCCGACATGCAGGAGCGATCTGTCGACACCGTGCTTGCGCGGCTTCCCGACGATGCGT
CGGTTCGCGAGCTGATGCGGCCGTTCGCGCCGCTGCTCGACGATGCGGATGTGACTGAACTCGTCATCAA
CCGGCCGCAGCGCGTGCTCACCGAAACACATCTTGGCTGGCATGGTCACGACTACGACGACCTCGATTAT
GAGCGCCTGATGTCATTCGCGGTGGCGGTTGCGACGCTGACCAACCAGGAGGTATCAGCACAGCATCCGG
TGCTCTCCGCGTTACTGCCCGGAGACGCGCGCATCCAGATCGTGGTGCCGCCCGTCGTGCCGCCGCGCAC
AGTTTCCGTGACGATCCGCCGGCCTTCTGCCCGCGAAAAGAGCCTCGACGCGTACCGTGACGAAGGGCTG
TTCGACGACACTCTGTGGCACCGTCCGGATGGACTTGACGCCGCGTTGCCGACGCTGCGCCCGACAGATC
GGAGGCTCGTGCGGTGCCTCGAAGAGCGGTACTGGTGCGCCTTCTTCGAGCAGGCCGTGACCGGCCGCCT
GAACATCGTGATCGTCGGCAATACGGGGTCGGGCAAGACCAGTTTTATGAAGACGCTTTGCCGGTCGATT
CCGTCGACCGAGCGGATTGTGACGATCGAGGATGTCCGCGAACTCTTCATCCGGCATATCGAAAACTGTG
TGCACCTGCTGTACAGCAAGGGCGGTCACGGACAGGCGCGTGTGACGCCGGCCGATCTGATCGCGAGCAC
GATGCGCATGCGGCCCGACCGCGTGCTGCTCGCCGAACTGCGCGGCGCCGAAGCCTATGACTTTCTGAAG
CTGCTGACGACCGGCCACGTCGGCTCGATCACAAGCTATCACGCATCAAGCGCGACCGTTGCAATCGAGC
GCTTTGCGCTGATGGCGAAAGAGCATCCTGAAGCTGCTGCCTACGACGATGCCGCACTGAAACGCCTGCT
CGCCCTGACGATCGACGTGGTCGCCCACATGGAGGCATATCCGCTTTACGACGCGGCGGGCGAACAGATC
GGCAAGCGCTGGGGCATGACAGAAATCTGGTTCGATCCGGTGCGCCGCGCGCGCACGACGTTTTCGTGA
 Primer design