SecReT4
Protein ID: 187921143
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6498
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2788418..2789662 [-]
Productconjugation TrbI family protein
Component typeVirB10
UniProt IDB2T8Z1
KEGG IDbpy:Bphyt_6498
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.7e-56, Aligned region: 226..402
Protein Sequence: 414 a.a.     [Download]
>gi|187921143|ref|YP_001890175.1| conjugation TrbI family protein [Burkholderia phytofirmans PsJN]
MSDDIRNTIEPDDPSDRRPDGASPNGINWSAEPLDRGMPALGQYGGTRPRAWWLTPLVVVLVAGAGAVWT
VHTFLARHDAEAKAHRDAVQDTATQGRVFRDAPVAASAASRPVATIAPAAVSGPVVARPPVAVQHPALVR
SYYDAPLLAVGNTPGASGRREGLADGLAAGGVPGNVVDAASSVAASVSGRPLTTPGQGGIGALDQALTPT
ATPRVHAGTIGDRSLVLAQGAKIDCAGDTAFDSTEAGLSTCTVTKNVYSDDGRVVLIERGSQIDSQYRSN
LSPGQKRTFILAARIETPHGVTVEIDSPAADALGRMGIDGYVDNHWGQRIGAAMLLGITQDAIGYLATRG
GNSNGSVVYENTQQQGNDMATRVLDSTINIPPTLTQNQGAEFTIVVARDLDFGTVYALQPERAP
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2789662-2788418 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAGTGACGACATCCGCAACACGATCGAACCGGATGATCCGTCCGACCGTCGTCCGGATGGCGCTAGCC
CGAATGGCATCAACTGGTCCGCGGAGCCGCTTGATCGGGGCATGCCTGCACTCGGGCAGTACGGGGGCAC
GCGCCCGCGCGCCTGGTGGCTGACACCGCTGGTGGTTGTTCTCGTGGCCGGCGCTGGTGCGGTCTGGACG
GTTCACACGTTCCTCGCACGTCACGACGCGGAGGCGAAAGCGCACCGCGATGCGGTGCAGGATACCGCGA
CGCAGGGACGCGTTTTCAGGGACGCGCCGGTGGCCGCGAGCGCGGCGTCCAGACCGGTCGCAACAATTGC
GCCTGCCGCGGTCTCGGGCCCGGTTGTCGCCCGTCCGCCTGTCGCGGTCCAGCATCCGGCGTTGGTCCGG
AGTTACTACGATGCGCCGTTACTTGCGGTCGGTAATACGCCCGGCGCCAGTGGCCGGAGGGAAGGCCTGG
CGGACGGGCTTGCTGCCGGGGGCGTTCCAGGCAACGTCGTGGACGCAGCTTCTTCGGTCGCGGCATCGGT
ATCCGGCCGGCCGTTGACGACGCCGGGCCAAGGCGGGATCGGGGCACTTGACCAGGCGTTGACCCCGACC
GCCACGCCGCGGGTGCATGCCGGCACGATCGGTGACCGCAGCCTGGTGCTCGCGCAGGGAGCCAAGATCG
ATTGCGCAGGCGACACGGCGTTCGATTCGACGGAAGCGGGGCTGTCGACCTGCACGGTGACGAAGAACGT
CTATTCCGATGACGGGCGGGTCGTGCTGATCGAGCGTGGATCGCAGATCGACAGCCAGTATCGTTCGAAC
CTGTCGCCCGGCCAGAAGCGGACGTTCATCCTCGCGGCCCGTATCGAGACGCCCCACGGCGTGACCGTCG
AGATCGATTCTCCGGCAGCGGACGCGCTCGGCCGCATGGGGATCGATGGCTATGTCGACAACCACTGGGG
GCAGCGCATCGGCGCCGCGATGCTGCTCGGCATCACCCAGGACGCGATCGGGTATCTCGCCACGCGAGGC
GGTAACAGCAACGGGTCCGTCGTCTACGAGAACACGCAGCAGCAGGGTAACGACATGGCGACGCGGGTGC
TCGACAGCACGATCAATATTCCGCCGACGCTGACACAGAACCAGGGCGCGGAATTCACGATCGTCGTCGC
GCGCGATCTCGATTTCGGAACGGTCTATGCATTGCAGCCGGAGCGCGCGCCATGA
 Primer design