SecReT4
Protein ID: 187921144
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6499
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2789655..2790485 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeVirB9
UniProt IDB2T8Z2
KEGG IDbpy:Bphyt_6499
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.7e-62, Aligned region: 32..248
Protein Sequence: 276 a.a.     [Download]
>gi|187921144|ref|YP_001890176.1| conjugal transfer protein TrbG/VirB9/CagX [Burkholderia phytofirmans PsJN]
MKTLRVSVLCLVGLLVLSPVARSWTVPGWSDDSRVRQIVYAPDAVVRINAQRGFATHIALDPHEQIQVVA
PGDRDGWQVVANRGDHDVFLKPQLAAHNSNLEIRTDKRSYSFDLVVLPLKAKFGNGDEIYRVTFVYPDEL
KAQTHAETDAALVAQRLAQPSVVRNTRYSMQVMPHSDDIAPIAAWDDGRFTWIRIPANRRIPAIFRVADD
GTESVVDKHMEDGTIVVHEVAKRFVLRLGDEVVGIWNDAYDMDGVPPSDGTTVYGVRRVLRSLDHE
 
Nucleotide Sequence: 831 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2790485-2789655 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAAAACGCTCCGTGTTTCGGTGCTCTGCCTTGTGGGTCTGCTGGTGCTGAGTCCGGTCGCACGGTCCT
GGACCGTGCCGGGCTGGTCCGATGACTCACGGGTGCGGCAGATCGTATATGCGCCCGACGCCGTCGTGCG
CATCAATGCACAGCGAGGCTTCGCCACCCATATCGCCCTCGACCCGCATGAGCAGATCCAGGTAGTCGCA
CCCGGCGATCGCGATGGCTGGCAGGTGGTGGCGAACAGGGGTGACCACGACGTTTTCCTGAAACCGCAGC
TCGCCGCGCACAACTCGAATCTCGAGATCCGTACGGACAAACGCAGCTACAGCTTCGACCTGGTGGTGCT
GCCCCTGAAGGCGAAATTCGGCAACGGCGACGAGATATATCGGGTGACGTTCGTCTATCCGGACGAGCTC
AAGGCTCAGACCCATGCCGAAACCGATGCGGCGCTGGTGGCGCAGCGTCTTGCCCAGCCGTCGGTGGTGC
GCAACACCCGGTACTCGATGCAGGTCATGCCGCATTCGGACGATATTGCGCCGATCGCGGCGTGGGATGA
CGGGCGGTTCACCTGGATCCGCATTCCTGCCAACCGGCGCATCCCGGCGATCTTCCGGGTGGCGGATGAC
GGTACCGAAAGCGTGGTCGACAAGCACATGGAGGACGGCACGATCGTCGTTCACGAGGTGGCGAAGCGCT
TCGTATTGCGGCTCGGCGATGAGGTTGTTGGCATCTGGAATGACGCATACGACATGGACGGTGTGCCGCC
CAGTGACGGCACGACGGTCTATGGTGTGAGGCGTGTTTTGCGGAGTCTGGATCATGAGTGA
 Primer design