SecReT4
Protein ID: 187921145
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6500
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2790482..2791186 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDB2T8Z7
KEGG IDbpy:Bphyt_6500
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.1e-52, Aligned region: 12..220
Protein Sequence: 234 a.a.     [Download]
>gi|187921145|ref|YP_001890177.1| VirB8 family protein [Burkholderia phytofirmans PsJN]
MSTGDDYGRVLDIEASLTHLQEQSERRAWHVAYGAVGVAVLSVMALAVMVPFYRVVPLPIEVDRLTGESQ
VIDVLDARHVHTREIQDKHWVEAYVRERERYDWGLLQMDYDSVLAMSDDVVARDYRGTYSGPDALDRQLG
PNTERRVRILSTTLPPDEPGHAVVHIERTTFKNGQANAEPTQRFVVTLAYAYRPPVFTRESVAVANPFGF
KVTAYSRDPEYTPPASSSSAGGAP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2791186-2790482 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAGCACCGGTGACGACTATGGACGCGTGCTCGACATTGAGGCGTCACTGACACACCTGCAGGAGCAAT
CTGAGCGACGGGCCTGGCACGTGGCGTACGGGGCGGTTGGTGTGGCCGTGCTCAGTGTGATGGCGCTCGC
CGTCATGGTGCCGTTCTACCGGGTGGTGCCTTTGCCGATTGAGGTCGATCGCCTGACGGGCGAATCGCAG
GTGATCGATGTGCTCGACGCGCGTCACGTGCATACGAGGGAAATCCAGGACAAGCACTGGGTTGAAGCAT
ACGTGCGCGAGCGTGAACGCTATGACTGGGGGCTGCTGCAGATGGACTACGACAGCGTGCTCGCCATGAG
CGATGACGTGGTCGCGCGCGACTACCGGGGCACTTACAGCGGCCCCGATGCGCTGGACCGGCAGCTCGGC
CCGAACACGGAGCGGCGCGTGCGGATTCTTTCGACGACGCTGCCTCCCGATGAACCCGGGCACGCGGTTG
TGCATATCGAGCGCACGACATTCAAAAACGGTCAGGCGAACGCCGAGCCGACGCAGCGCTTCGTCGTCAC
GCTGGCTTACGCCTATCGGCCGCCGGTTTTCACACGCGAAAGCGTGGCCGTTGCGAATCCGTTCGGCTTC
AAGGTGACGGCTTACAGCCGCGATCCTGAATATACGCCGCCGGCATCATCGTCGAGCGCGGGAGGTGCGC
CATGA
 Primer design